KEGG   Sorangium cellulosum So ce 56: sce8557Help
Entry
sce8557           CDS       T00634                                 

Gene name
glpX
Definition
fructose-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sce8557 (glpX)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce8557 (glpX)
   00030 Pentose phosphate pathway
    sce8557 (glpX)
   00051 Fructose and mannose metabolism
    sce8557 (glpX)
  Energy metabolism
   00680 Methane metabolism
    sce8557 (glpX)
Enzymes [BR:scl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     sce8557 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11929203..11931128
Genome map
AA seq 641 aa AA seqDB search
MLDTRELPLLRALAGRYPTTEAALSEIGHLRAILSLPKGTVHVVSDVHGEHRKLKHIINN
ASGSLRPLVERVFGDRLTAAEERALLSAVYYPRERYARVASHSEGARWAFLIWTLAREVE
VIRALSLRYTLRQVEAAFPEDMRGLLRELVSARATLGEGGYLDALLDPFVQHGREIEILR
ATARAIRNLTVFELVVAGDLGDRGPRLDKVIEYLMRQPRVRVVWGNHDVSWMGASLGQEA
LIATVVRLSLRYGRLSQLEEGFGISVAPLDRLARTAYADDPAERFAVRGEGLRDALLMAR
MQKAAAVLQFKLEGQLCRRRPEYALEHRCLLHRIDARAGTVAIDGEVFPLLDARFPTLDP
GDPYALTPDEAACVALLKESFLRSPALSRQMRWMVQQGTTWLRRDRALIFHGCVPVDGEG
ELLPFVVDGEVRRGRALFDALERTVRRAFRAGAQEDVDMLWYLWTGPLSPMFGKDRMTTF
ESYFVADERTHRETKNPYFHLIHDAAFCGRVCREFGVDEERGLIVNGHVPVRVERGESPI
KASRRAVTIDGAFSEAYGDKGYTLVLEASGARLAQHHHFTSVEQAVEAGEDIIPVISDVE
VYEAERRVGDTEKGEEIEREIELLERLIEAYRDGALLEQPR
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacgcgggagttgccgctcctccgggccctcgcgggccgatacccgacgacc
gaggccgcgctctcggagatcggccatctgcgggcgatcctgtcgctcccgaaggggacg
gtgcacgtggtcagcgacgtccacggcgagcacaggaagctgaagcacatcatcaacaac
gcctcggggagcctgcggccgctggtcgagcgggtcttcggcgaccggctcacggcggcc
gaggagcgcgcgctgctctcggccgtctactaccctcgcgagaggtatgcccgcgtcgcg
tcccacagcgagggggcgcggtgggccttcctgatctggacgctcgcgcgcgaggtcgag
gtcatccgcgcgctgtcgctgcgctacacgctccgccaggtggaggcggcgttcccggag
gacatgcggggcctgctccgcgagctcgtgtcggcgcgcgccaccctcggcgagggcggc
tacctcgacgcgctcctcgatccgttcgtgcagcacggccgcgagatcgagatcttgcgc
gccacggcgcgcgccatccggaacctgacggtcttcgagctcgtggtggccggcgatctc
ggcgatcgcggtccccggctcgacaaggtgatcgagtacctgatgcgccagccgcgcgtg
cgggtcgtgtggggcaaccacgacgtgagctggatgggcgcgagcctcggccaggaggcg
ctcatcgccacggtcgtccggctctcgctgcggtacgggcgcctgtcgcagctggaagag
ggctttggcatctccgtggcgccgctcgatcggctcgcgcgcacggcctacgccgacgat
ccggcggagcgcttcgcggtccggggcgaggggctgcgcgacgccctgctgatggcgcgg
atgcagaaggccgcggccgtcctccagttcaagctggaggggcagctctgccggcgccgc
ccggagtacgcgctcgagcaccgctgcctgctccatcgcatcgacgcgcgcgcgggcacg
gtcgcgatcgacggcgaggtgttcccgctgctcgacgcgcgcttcccgacgctcgacccc
ggcgatccgtacgcgctgacgccggacgaggcggcgtgcgtcgcccttctgaaggagtct
ttcctgaggagcccggcgctgtcccgccagatgcgctggatggtgcagcaggggacgacg
tggctcaggcgcgaccgggcgctcatcttccacggctgtgtcccggtggacggcgagggc
gagctccttcctttcgtggtggacggcgaggttcgccgcggcagggcgctgttcgacgcg
ctggagcggacggtgcgccgggccttccgggcgggcgcgcaggaggacgtcgacatgctc
tggtacctctggaccgggccgctctcgcccatgttcggcaaggaccggatgacgacgttc
gagtcgtatttcgtcgccgacgagaggacgcacagggagacgaagaacccttatttccac
ctgatccacgacgccgcgttctgcggccgggtgtgccgcgagttcggtgtggacgaggag
cgcgggctcatcgtgaacgggcacgtgccggtccgggtcgagcggggggagtcgccgatc
aaggcgtcgcgccgcgcggtgacgatcgacggggcgttctcggaggcgtacggcgacaag
gggtacacgctcgtgctcgaggcgagcggggcgcggctcgcgcagcaccaccatttcacg
tcggtcgagcaggccgtcgaggcgggggaggacatcatccccgtgatctccgacgtggag
gtctacgaggccgagcgccgggtgggagacaccgagaagggggaggagatcgagcgggag
atcgagctcctggagcggctcatcgaggcgtatcgagacggagcgctcctcgagcagccg
aggtga

DBGET integrated database retrieval system