KEGG   Sorangium cellulosum So ce 56: sce8725Help
Entry
sce8725           CDS       T00634                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sce8725 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    sce8725 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    sce8725 (aceB)
Enzymes [BR:scl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     sce8725 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12175483..12177105
Genome map
AA seq 540 aa AA seqDB search
MSQNHETASVRLLAPRVGGDESVLTPEALRFLSGLGRKFADRVPALLARRRAVQERLDAG
ERFDFLPETRDVREGDWTVAPLPEDLLDRRVEITGPVDPKMIINALNSGASVFMADFEDA
TSPTWKNLIEGQAALRLAARRELRYDDPATGKRYALGDRLATLLVRPRGWHLPERHVELD
GKPLPGGLFDFGLYFFHNARELVRRGTGPYFYLPKMESHLEARLWNDVFVFAQEALGLPI
GTIKATVLIETLPAAFEMDEILHELRQHSAGLNCGRWDYIFSFIKKLRNDPACVMPDRSQ
VTMEQHFLRSYTQLLVKTCHRRGVHAMGGMAAQIPIKSDPEANRAALDKVRADKLREVKD
GHDGTWVAHPGLVPLAREVFDAHMPAANQIERKREDVRVSAADLLRVPEGARTEAGLRHN
IRVGVQYLEAWISGLGCVPLYNLMEDAATAEISRTQVWQWIRHGATLDDGQPLTVERFRA
AVDGEMAALRGALGPARFDGGRFAEARALFERLSIGETFEEFLTLPAYELLISSAGERRS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaatcatgagaccgcaagcgtccgcttgctcgctcctcgggtcgggggcgac
gagtccgtcctcacgccagaggcccttcgtttcctctccggtcttgggcgcaagttcgct
gaccgggtgcccgccctgctcgcccggcggcgcgccgtgcaagagcggctggacgcgggc
gagcggttcgattttctccccgagacgcgggatgtgcgcgagggcgactggacggtggcg
ccgctgcccgaggacctcctcgaccggcgcgtggagatcacgggtccggtcgatcccaag
atgatcatcaacgcgctgaactcgggcgcgagcgtgttcatggccgacttcgaggacgcc
acgtcgcccacgtggaagaacctcatcgaggggcaagcggcgctgaggctcgcggcgcgg
cgcgagctccggtacgacgacccggcgaccggcaagcgttacgccctcggagacaggctg
gcgacgctgctcgtgcgcccgcgcggctggcacctccccgagaggcacgtcgagctcgac
ggcaagccgctgccaggcgggctcttcgatttcggactctatttcttccacaacgcgcgt
gagctcgtccgccgcggtaccgggccttacttctatctgccgaagatggagagtcacctg
gaggcgcgcctctggaacgacgtcttcgtgttcgcgcaggaggcgctcggcctccccatc
ggcacgatcaaggccacggtcctcatcgagacgctgcccgcggcgttcgagatggacgag
atcctccacgagctccggcagcactcggccggcctcaactgcggtcgctgggactacatc
ttcagcttcatcaagaagctccggaacgaccccgcctgcgtgatgccggaccgctcgcag
gtgacgatggagcagcatttcctgcgctcgtacacgcagctgctcgtgaagacgtgccac
cgccgcggcgtccacgcgatgggcggcatggcggcgcagatcccgatcaagagcgacccg
gaggcgaaccgcgcggcgctcgacaaggtgcgcgccgacaagctgcgcgaggtgaaggac
ggacacgacggcacctgggtcgcgcacccggggctcgtgccgctcgcgcgcgaggtgttc
gacgcgcacatgcccgctgcgaaccagatcgagcgcaagcgcgaggacgtccgcgtctcg
gcggccgacctgctgcgcgtcccggagggcgcgcgcaccgaggccggcctgcgccacaac
atccgggtcggcgtccagtacctcgaggcgtggatcagcgggctcggctgcgtcccgctc
tacaacctgatggaggacgcggccaccgcggagatctcccgcacccaggtctggcaatgg
atccgccacggggcgacgctcgacgacggccagccgctcaccgtggagcgcttccgcgcg
gcggtggacggcgagatggccgccctccgcggcgcgctcggcccggcgcgcttcgacggc
ggccgcttcgccgaggcgcgcgcgctgttcgagcggctgtcgatcggagagaccttcgag
gagttcctcacgctgcctgcttacgagctcttgatctccagcgccggagagcggcgctcg
tga

DBGET integrated database retrieval system