KEGG   Sorangium cellulosum So ce 56: sce8726Help
Entry
sce8726           CDS       T00634                                 

Gene name
aceA
Definition
(RefSeq) hypothetical protein
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sce8726 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    sce8726 (aceA)
Enzymes [BR:scl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     sce8726 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12177181..12178479
Genome map
AA seq 432 aa AA seqDB search
MSAAFPLNTPISADSLHAPPSDTVPGRWSGVVRPYSEADVARLRGTVRIDYTLATLGAKR
LWNLMHAEPYVAALGALTGNQAMQQVRAGLKAIYLSGWQVAADNNEAGTMYPDQSLYPAN
SVPTLVRRINQALLRADQIENAEGKAGRYWLAPIMADAEAGFGGPLNAFELMKAMIEAGA
SGVHFEDQLASEKKCGHMGGKVLVPTSQFIRTLIAARLASDVMGVPTVLVARTDADSAKL
ITSDVDPRDKPFVTGERTPEGFFVLKGGLEAAIARGLAYAPYADLVWCETSTPDLDQAKR
FAEGIHKQFPGKLLAYNCSPSFNWKKHLDDATIARFQRELGAMGYKFQFVTLAGFHSLNH
SMFELARQYQRRGMAAYSELQQAEFAGEQFGYSATRHQREVGTGYFDEVAQVISGGAAST
LALHESTEAAQF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgctttcccgctgaacacgccgatctccgccgactccctgcacgcgccgccg
agcgacaccgtcccgggccggtggagcggcgtcgtccgcccgtactccgaggcggacgtc
gcgcgcctccgcggcaccgtccgtatcgactacacgctcgcgaccctcggcgccaagcgg
ctctggaacctgatgcacgccgagccctacgtggcggcgctcggcgccctcaccggcaac
caggcgatgcagcaggtccgggccgggctcaaggccatctacctgagcgggtggcaggtg
gcggccgacaacaacgaggccgggaccatgtaccccgaccagagcctgtacccggcgaac
agcgtcccgacgctcgtgcgccgcatcaaccaggcgctcctccgcgccgaccagatcgag
aacgccgagggcaaggcggggcgctactggctcgcgcccatcatggccgacgcggaggcg
ggcttcggcgggccgctcaacgccttcgagctgatgaaggccatgatcgaggcgggcgcc
tcgggcgttcacttcgaggaccagctcgcctccgagaagaagtgcgggcacatgggcggc
aaggtcctcgtcccgaccagccagttcatccgcaccctgatcgcggcccgcctcgccagc
gacgtcatgggcgtaccgaccgtcctcgtggcccgcacggacgccgacagcgccaagctg
atcacgtccgacgtcgacccgcgcgacaagccgttcgtcacgggcgagcgcacccccgag
ggcttcttcgtgctgaagggcggcctcgaggcggccatcgcgcgcgggctcgcgtacgcg
ccctacgcggacctcgtctggtgcgagacctcgacgccggacctcgatcaggcgaagcgc
ttcgcggaggggatccacaagcagttcccgggcaagctgctcgcctacaactgctcgcct
tcgttcaactggaagaagcacctcgacgacgcgacgatcgcccggttccagcgcgagctc
ggcgcgatggggtacaagttccagttcgtgaccctcgccgggttccactcgctgaatcac
agcatgttcgagctcgcccgccagtaccagcgccgggggatggcggcgtactccgagctc
cagcaggccgagttcgccggcgagcagttcggctacagcgcgacccgccaccagcgcgag
gtcgggacgggctacttcgacgaggtcgctcaggtgatctcgggcggcgctgcgtccacg
ctggccctccacgagtccaccgaggccgcccagttctga

DBGET integrated database retrieval system