KEGG   Sorangium cellulosum So ce 56: sce8726Help
Entry
sce8726           CDS       T00634                                 

Gene name
aceA
Definition
(GenBank) High confidence in function and specificity
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
scl00630  Glyoxylate and dicarboxylate metabolism
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01200  Carbon metabolism
Module
scl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    sce8726 (aceA)
Enzymes [BR:scl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     sce8726 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAN98897
UniProt: A9G4E9
Position
12177181..12178479
Genome map
AA seq 432 aa AA seqDB search
MSAAFPLNTPISADSLHAPPSDTVPGRWSGVVRPYSEADVARLRGTVRIDYTLATLGAKR
LWNLMHAEPYVAALGALTGNQAMQQVRAGLKAIYLSGWQVAADNNEAGTMYPDQSLYPAN
SVPTLVRRINQALLRADQIENAEGKAGRYWLAPIMADAEAGFGGPLNAFELMKAMIEAGA
SGVHFEDQLASEKKCGHMGGKVLVPTSQFIRTLIAARLASDVMGVPTVLVARTDADSAKL
ITSDVDPRDKPFVTGERTPEGFFVLKGGLEAAIARGLAYAPYADLVWCETSTPDLDQAKR
FAEGIHKQFPGKLLAYNCSPSFNWKKHLDDATIARFQRELGAMGYKFQFVTLAGFHSLNH
SMFELARQYQRRGMAAYSELQQAEFAGEQFGYSATRHQREVGTGYFDEVAQVISGGAAST
LALHESTEAAQF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgctttcccgctgaacacgccgatctccgccgactccctgcacgcgccgccg
agcgacaccgtcccgggccggtggagcggcgtcgtccgcccgtactccgaggcggacgtc
gcgcgcctccgcggcaccgtccgtatcgactacacgctcgcgaccctcggcgccaagcgg
ctctggaacctgatgcacgccgagccctacgtggcggcgctcggcgccctcaccggcaac
caggcgatgcagcaggtccgggccgggctcaaggccatctacctgagcgggtggcaggtg
gcggccgacaacaacgaggccgggaccatgtaccccgaccagagcctgtacccggcgaac
agcgtcccgacgctcgtgcgccgcatcaaccaggcgctcctccgcgccgaccagatcgag
aacgccgagggcaaggcggggcgctactggctcgcgcccatcatggccgacgcggaggcg
ggcttcggcgggccgctcaacgccttcgagctgatgaaggccatgatcgaggcgggcgcc
tcgggcgttcacttcgaggaccagctcgcctccgagaagaagtgcgggcacatgggcggc
aaggtcctcgtcccgaccagccagttcatccgcaccctgatcgcggcccgcctcgccagc
gacgtcatgggcgtaccgaccgtcctcgtggcccgcacggacgccgacagcgccaagctg
atcacgtccgacgtcgacccgcgcgacaagccgttcgtcacgggcgagcgcacccccgag
ggcttcttcgtgctgaagggcggcctcgaggcggccatcgcgcgcgggctcgcgtacgcg
ccctacgcggacctcgtctggtgcgagacctcgacgccggacctcgatcaggcgaagcgc
ttcgcggaggggatccacaagcagttcccgggcaagctgctcgcctacaactgctcgcct
tcgttcaactggaagaagcacctcgacgacgcgacgatcgcccggttccagcgcgagctc
ggcgcgatggggtacaagttccagttcgtgaccctcgccgggttccactcgctgaatcac
agcatgttcgagctcgcccgccagtaccagcgccgggggatggcggcgtactccgagctc
cagcaggccgagttcgccggcgagcagttcggctacagcgcgacccgccaccagcgcgag
gtcgggacgggctacttcgacgaggtcgctcaggtgatctcgggcggcgctgcgtccacg
ctggccctccacgagtccaccgaggccgcccagttctga

DBGET integrated database retrieval system