KEGG   Sorangium cellulosum So ce 56: sce8726Help
Entry
sce8726           CDS       T00634                                 

Gene name
aceA
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sce8726 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    sce8726 (aceA)
Enzymes [BR:scl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     sce8726 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12177181..12178479
Genome map
AA seq 432 aa AA seqDB search
MSAAFPLNTPISADSLHAPPSDTVPGRWSGVVRPYSEADVARLRGTVRIDYTLATLGAKR
LWNLMHAEPYVAALGALTGNQAMQQVRAGLKAIYLSGWQVAADNNEAGTMYPDQSLYPAN
SVPTLVRRINQALLRADQIENAEGKAGRYWLAPIMADAEAGFGGPLNAFELMKAMIEAGA
SGVHFEDQLASEKKCGHMGGKVLVPTSQFIRTLIAARLASDVMGVPTVLVARTDADSAKL
ITSDVDPRDKPFVTGERTPEGFFVLKGGLEAAIARGLAYAPYADLVWCETSTPDLDQAKR
FAEGIHKQFPGKLLAYNCSPSFNWKKHLDDATIARFQRELGAMGYKFQFVTLAGFHSLNH
SMFELARQYQRRGMAAYSELQQAEFAGEQFGYSATRHQREVGTGYFDEVAQVISGGAAST
LALHESTEAAQF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgctttcccgctgaacacgccgatctccgccgactccctgcacgcgccgccg
agcgacaccgtcccgggccggtggagcggcgtcgtccgcccgtactccgaggcggacgtc
gcgcgcctccgcggcaccgtccgtatcgactacacgctcgcgaccctcggcgccaagcgg
ctctggaacctgatgcacgccgagccctacgtggcggcgctcggcgccctcaccggcaac
caggcgatgcagcaggtccgggccgggctcaaggccatctacctgagcgggtggcaggtg
gcggccgacaacaacgaggccgggaccatgtaccccgaccagagcctgtacccggcgaac
agcgtcccgacgctcgtgcgccgcatcaaccaggcgctcctccgcgccgaccagatcgag
aacgccgagggcaaggcggggcgctactggctcgcgcccatcatggccgacgcggaggcg
ggcttcggcgggccgctcaacgccttcgagctgatgaaggccatgatcgaggcgggcgcc
tcgggcgttcacttcgaggaccagctcgcctccgagaagaagtgcgggcacatgggcggc
aaggtcctcgtcccgaccagccagttcatccgcaccctgatcgcggcccgcctcgccagc
gacgtcatgggcgtaccgaccgtcctcgtggcccgcacggacgccgacagcgccaagctg
atcacgtccgacgtcgacccgcgcgacaagccgttcgtcacgggcgagcgcacccccgag
ggcttcttcgtgctgaagggcggcctcgaggcggccatcgcgcgcgggctcgcgtacgcg
ccctacgcggacctcgtctggtgcgagacctcgacgccggacctcgatcaggcgaagcgc
ttcgcggaggggatccacaagcagttcccgggcaagctgctcgcctacaactgctcgcct
tcgttcaactggaagaagcacctcgacgacgcgacgatcgcccggttccagcgcgagctc
ggcgcgatggggtacaagttccagttcgtgaccctcgccgggttccactcgctgaatcac
agcatgttcgagctcgcccgccagtaccagcgccgggggatggcggcgtactccgagctc
cagcaggccgagttcgccggcgagcagttcggctacagcgcgacccgccaccagcgcgag
gtcgggacgggctacttcgacgaggtcgctcaggtgatctcgggcggcgctgcgtccacg
ctggccctccacgagtccaccgaggccgcccagttctga

DBGET integrated database retrieval system