KEGG   Sorangium cellulosum So ce 56: sce8804Help
Entry
sce8804           CDS       T00634                                 

Gene name
asnB3
Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:scl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(12294454..12296259)
Genome map
AA seq 601 aa AA seqDB search
MCSIAGIFNKKHPIGAAQRDEMASLLEAMHHRGPDARGALQCASWALLGSNRLRITDAGN
PGADMPLTSADQRLAIVFNGEIYNHRDLRARLSGFPFRTASDTEVILAAYEAWGLACVEH
LEGMFAFALFDSATQTGLIACDPTGQKTVYLWEDDDALVFASEIDPLIKDPYRRKDWDLD
GLAEFTAHRFILGSATHVRQIRKLESGTWLTRTPERQETGRFYRIPRGDLARTDVPAIRQ
EIRDAVIDGCQRTFDLEVPYGLLLSGGIDSTAVLAAARRAGLPMRTFSIGFQPTGQLLPR
STSVFDEFAYSRALAREHETQHTEITLSDTDYCAYLDRWIETAGEPLGSQEAPCLIRLFE
EAGREARVIFSGSGPDEIFDGYSYGRAMADVPLAELAERYFAAFHWSGKADLRQLMPRHD
AARLTTRKYRQILSLYSDWPLDSLQAVQLLHFHGRLVVYEFRQMDLISMRHGVEARSPLA
SAGLARVAFDFQSELKQQGGSEKGIYKQALVDLVPPAIASRKKQGFPIPAEMWFSRPFAD
RAAILFDKGCVLSGAGLVDPSYLRRLWEDPDPATRNLFSRLYTAEGILRRQAPHLAPSRA
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgatcgctggcatcttcaacaagaagcatcccatcggcgccgcgcagcgcgac
gagatggcgtcgctcctcgaggcgatgcaccaccggggaccggacgcgcggggcgccctg
caatgcgcgagctgggccctgctcggcagcaaccggctgcgcatcaccgacgccgggaac
cccggcgcggacatgccgctcacctcggccgatcagcgcctcgccatcgtcttcaacggc
gagatctacaaccaccgtgacctgcgcgcgcggctgtcggggttcccgttcaggaccgcc
tcggacaccgaggtcatcctcgcggcgtacgaggcatgggggctcgcctgcgtggagcac
ctcgagggcatgttcgccttcgccctgttcgacagcgcgacgcagacggggctcatcgcc
tgcgaccccaccggacagaagaccgtttacctgtgggaggacgacgacgccctggtcttc
gcctccgagatcgacccgctcatcaaggacccttaccgcaggaaggactgggacctcgac
ggcctcgcggagttcaccgcgcaccgcttcatcctgggcagcgccacgcacgtccggcag
atccgcaagctcgagtccggcacctggctgaccaggacgcccgagcggcaagagacgggg
cgcttctaccggatcccgcgcggcgacctggcgaggaccgacgtccccgcgatccggcag
gagatcagggacgcggtcatcgacggatgccagaggacgttcgacctcgaggtcccctac
ggtctcctgctgagcggcggcatcgactccacggcggtcctcgccgcggcccgccgcgcc
ggcctgccgatgaggacgttctccatcggctttcagccgacgggtcagctcctcccgagg
agcaccagcgtcttcgacgagttcgcctattcgagggcgctcgcccgcgagcacgaaacg
cagcacaccgagatcaccctgtcggacaccgactactgcgcttacctcgaccggtggatc
gagaccgccggcgagccgctcgggtcccaggaggcgccctgcctcatccggctcttcgag
gaggccgggcgagaggcgcgcgtgatcttctccgggagcgggcctgacgagatcttcgac
gggtactcctacggtcgggcgatggcggacgtgcccctcgccgagctcgccgagcgctac
ttcgccgcctttcactggtccggcaaggccgacctgaggcagctcatgccgcgccacgac
gccgcgcgcctgacgacccgcaaataccgccagatcctctcgctctacagcgactggccg
ctcgacagcctgcaggccgtccagctcctgcacttccacggccggctcgtcgtctacgag
ttccggcagatggatctcatcagcatgcgccacggcgtcgaggcccgctcgcccctcgca
agcgccgggctcgcccgcgtcgccttcgatttccagagcgagctgaagcaacagggcggc
tccgagaaggggatctacaagcaggccctcgtcgatctcgtccctccggcgatcgcctcg
cgcaagaagcaagggttccccatccccgcggagatgtggttctcgaggccgttcgcggac
agggccgccatcctcttcgacaagggctgcgtgctgagcggcgctggcctcgtcgacccg
agctacctgaggaggctctgggaagatccggacccggccacgcgcaacctgttctcgcgc
ctgtacacggccgagggcatcctccgtcgccaggcgccgcacctcgcgccgtcgcgggcc
gcctga

DBGET integrated database retrieval system