KEGG   Sorangium cellulosum So ce 56: sce8993Help
Entry
sce8993           CDS       T00634                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    sce8993
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     sce8993
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     sce8993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12532342..12532806
Genome map
AA seq 154 aa AA seqDB search
MRAIRMRADGEGEATEAELEAEGIRCGAFDPGAAALALQRVVADRGWTEHEDVRRDGSKP
RDEAESAREADEHCHLGDEVRLFVEGQGCYDIRCTNDDWLRIWVGAGDLIAVPVRRYHRF
MASKAGAIRYLQPYGGRHLLMQLYRVSDDRTRAM
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgatccgaatgagagctgacggcgagggcgaggccaccgaggcggagctcgag
gcggaagggatccggtgcggcgcgttcgacccgggcgcagctgcgctcgccttgcagcgc
gtggtcgcggaccgcggatggacggagcacgaggatgtccgccgcgacgggagcaagccg
cgcgacgaggcagagagcgcgagagaggcggatgagcactgtcacctcggcgacgaggtg
cggctcttcgtggagggacagggctgttacgacatccgttgcacgaacgacgattggctg
cggatctgggtcggcgcgggcgatctcatcgccgtgccggtgcggcgctaccatcgcttc
atggcgagcaaggccggcgcgatccgctacctgcagccgtacggcggccgtcacctgctc
atgcagctctaccgcgtgtccgatgatcggacgcgcgcgatgtga

DBGET integrated database retrieval system