KEGG   Sorangium cellulosum So ce 56: sce9142Help
Entry
sce9142           CDS       T00634                                 

Gene name
sucC
Definition
succinate--CoA ligase (ADP-forming) (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sce9142 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    sce9142 (sucC)
   00640 Propanoate metabolism
    sce9142 (sucC)
   00660 C5-Branched dibasic acid metabolism
    sce9142 (sucC)
Enzymes [BR:scl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     sce9142 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(12732779..12733975)
Genome map
AA seq 398 aa AA seqDB search
MKIHEYQGKQLFARYGVPVPKGEPAFQASEVAPIADRLIAQTGNPVVVVKAQIHAGGRGK
GGGVKVAKGGSAEATALAEKILGMQLVTKQTGPEGQKVRRLYIEQGLDIARELYFAMLVD
RERRRIAVIASTEGGMDIEEVAHSTPEKIYKLFIDPVLGLAPYQGRQLAIALGLTAKETQ
RQFLKLVASLYACFTAEDCSLLEINPLVVTGAGDVFALDAKVSFDDNAEFRHADWNGMRD
VDEEDPVELQAKRAGLSYVSLDGDIGCLVNGAGLAMATMDIILHYGGKPANFLDVGGGAS
QEQVKTAFQIILRSERVRGIFVNIFGGIMRCDVVAAGVIAAAKELGLKVPLVVRLEGTNV
EAGRKLLDESGLTIQSASSMADGAQKIVAATRGGKAGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccacgagtatcaaggcaagcagctcttcgctcgctacggagtgccggtaccg
aaaggggagcccgctttccaggcgagtgaggtggcgccgatcgccgatcggctgatcgcc
cagacaggcaacccggtcgtcgtcgtgaaggcgcagatccacgcgggcggccgcggcaag
ggcggcggcgtcaaggtcgcgaagggtggcagcgcggaggcgaccgccctcgccgagaag
atcctcggcatgcagctcgtcaccaagcagacgggccccgaggggcagaaggtccgacgg
ctctacatcgagcagggcctcgacatcgcgcgcgagctctacttcgcgatgctcgtcgat
cgcgagcgccgccgcatcgcggtgatcgcctcgaccgagggcggcatggacatcgaggag
gtggcccacagcacgccggagaagatctacaagctcttcatcgatccggtgctcggcctc
gccccgtaccaggggcggcagctcgcgatcgcgctcgggctcaccgcgaaggagacgcag
cgccagttcctgaagctcgtggcctcgctctatgcgtgcttcaccgcggaggactgctcg
ctgctcgagatcaacccgctcgtcgtgaccggcgccggcgacgtcttcgcgctcgacgcg
aaggtgagcttcgacgacaacgccgagttccggcacgccgactggaacgggatgcgcgac
gtcgacgaggaggatccggtcgagctgcaggcgaagcgggccgggctgtcctacgtgtcg
ctcgacggcgacatcggctgcctcgtgaacggcgccgggctcgcgatggcgacgatggat
atcatcctccattacggcggaaagccggcgaacttcctggacgtcggcggcggcgcctcg
caggagcaggtgaagaccgcgttccagatcatcctccggagcgagcgggtccgcggcatc
ttcgtgaacatcttcggcggcatcatgcgctgcgacgtcgtcgcggccggggtcatcgcc
gcggcgaaggagctcgggctcaaggtgcctctcgtggtgcgcctcgaggggacgaacgtc
gaggccggccgcaagctgctcgacgagagcggcctgaccatccagtcggcgagctccatg
gccgacggcgcgcagaagatcgtggccgccacgcgcggcggcaaggccggcgcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system