KEGG   Sorangium cellulosum So ce56: sce9145Help
Entry
sce9145           CDS       T00634                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00520  Amino sugar and nucleotide sugar metabolism
scl00550  Peptidoglycan biosynthesis
scl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    sce9145 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    sce9145 (murA)
Enzymes [BR:scl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     sce9145 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:scl01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   sce9145 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase RTC
Motif
Other DBs
NCBI-ProteinID: CAN99318
UniProt: A9GD73
Position
complement(12735920..12737188)
Genome map
AA seq 422 aa AA seqDB search
MDSIRIRGGKPLSGKIRISGAKNAALPILCATLLSDGESLLRNVPALRDIETTSALLRFL
GRNVETAPPLVKVGAGDNVRPEAPYELVKQMRASVMVLGPLLARFGRAKVSLPGGCQIGT
RPVDQHLKGLEALGATIRLSRGYIVAECKRLRGAEVVFDLPTVTGTENLMMAAALAKGRT
TLVNCAREPEVEELGRVLNKMGARVSGAGTDVIHIEGADELEPFDHAIISDRIEAGTYMV
AAAAAGGDVLIENAPLEDLEAVAAKLRQAGVEVGREGDCVRVRREGRPLRAVDVTTAPHP
GFPTDMQAQFMVLMCLAQGTSRIVETIFENRFMHVPELARMGAHIDVDGHTAHVHGGAPL
SGATVMATDLRASASLVIAGLVATEGETEVLRVYHLDRGYEFMERKLAQLGADTARVEGR
DG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggactccatccggatccggggcgggaagccgctctccggcaagatccgcatcagcggc
gcgaagaacgccgcgctgccgatcctctgcgcgacgctgctctccgacggggagagcttg
ctccgcaacgtgcccgcgctgcgcgacatcgagacgacctcggcgctgctccggttcctc
gggcgcaacgtcgagaccgcgccgccgctcgtgaaggtcggcgccggcgacaacgtgcgg
cccgaggcgccttacgagctcgtcaagcagatgcgcgcgagcgtcatggtcctcggcccg
ctgctcgcgcgcttcggccgcgccaaggtgtcgctccccggcggctgccagatcgggacg
cgcccggtggatcagcacctcaagggcctcgaggcgctcggcgcgacgatccggctgtcg
cgcggctacatcgtcgcggagtgcaagcggctgcgcggcgccgaggtcgtgttcgatctg
ccgacggtgaccggcaccgagaacctgatgatggccgcggcgctcgcgaaggggcggacc
acgctggtcaactgcgcgcgcgagcccgaggtcgaggagctcggccgggtgctcaacaag
atgggcgcgcgcgtgagcggcgccggcacggacgtcatccacatcgagggcgcggacgag
ctggagccgttcgaccacgcgatcatctccgatcggatcgaggccggcacgtacatggtc
gcggcggccgcggccggcggcgacgtgctgatcgagaacgcgccgctcgaggacctcgag
gcggtcgcggccaagctccgccaggcgggcgtcgaggtgggccgcgagggcgactgcgtg
cgcgtccgccgcgaggggcggccgctgcgcgccgtcgacgtcacgacggcgccgcacccg
ggcttcccgaccgacatgcaggcgcagttcatggtcctgatgtgcctcgcgcagggcacg
tcgcgcatcgtcgagaccatcttcgagaaccgcttcatgcacgtccccgagctcgcgcgg
atgggggcgcacatcgatgtggacggccacacggcgcacgtgcacggcggcgcgccgctg
tcgggcgcgaccgtgatggccaccgatctgcgcgcgagcgcgtcgctcgtcatcgccggg
ctcgtggcgaccgagggcgagaccgaggtgctgcgcgtctaccacctggatcgcggctac
gagttcatggagcgcaagctcgcgcagctcggcgccgacacggcgcgcgtcgaggggcgg
gacggatga

DBGET integrated database retrieval system