KEGG   Sorangium cellulosum So ce 56: sce9154Help
Entry
sce9154           CDS       T00634                                 

Gene name
speB2
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:scl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12751595..12752563
Genome map
AA seq 322 aa AA seqDB search
MIVDNAFTADSLYGVRREPTYSGALSFLRRKYTRDLTGVDVAVTGIPLDTATSNRPGTRF
GPRAVREASAQLAWNRPYGYEFDPLDRLAVVDYGDCVWDYGRPEESPVAIEEHIGRILDA
GVTPLSIGGDHFVSYPILRAVSKRRGKLSLIHFDAHSDTWSDEVGSGRVDHGTMFFHAAR
EGLVEPSRSAQIGLRTYNADTLGFQVLDAPWVHRHGARAVIEHVRNIVGDHEVYLTFDID
FLDPSFAPGTGTPVCGGMSTAVALEILRGLQGIALVGMDVVEVAPAYDVGEITALAGATI
AQEGLGLIACRPGAPKAREPAG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtagacaacgcgttcacggccgatagcctctatggcgtccggcgcgagccgacc
tacagcggcgcgctctccttcctgcgccgcaagtacacgcgcgacctgactggcgtcgat
gtggcggtcaccggcatcccgctcgacacggcgaccagcaaccgcccagggacgcgcttc
ggcccgcgtgcggtgcgggaggcctcggcgcagctcgcgtggaaccgcccttacggctac
gagttcgatccgctcgaccggctcgccgtggtggactatggcgactgcgtctgggattac
gggcgtccggaggagagccctgtcgccatcgaggagcacatcggccgcattctcgacgcc
ggggtgacgcccctctcgatcgggggggatcacttcgtgagctacccgatcctgcgcgcc
gtgtccaagcgccgcgggaagctctcgctgatccatttcgacgctcactccgacacgtgg
agcgacgaggtcggatcgggtcgggtcgatcacggcaccatgttcttccacgcggcgcgg
gagggcctcgtggagcccagccgctcggcgcagatcgggctccgcacctacaacgccgat
acgctcggcttccaggtgctcgacgcgccctgggttcatcgtcatggcgcgagggcggtg
atcgagcacgttcgtaatatcgtcggggaccacgaggtttacctgacgttcgacatcgat
ttcctcgacccgagcttcgcgccgggcaccggcacgccggtctgcggggggatgtccacc
gcggtcgcgctggagatcctgcgggggctccagggcatcgcgctcgtcggcatggacgtc
gtggaggtcgcgcccgcgtacgacgtcggtgaaattacggcgctggccggcgcgacgatc
gcgcaggaggggctcgggctcatcgcgtgccggccgggggcgcccaaagcaagggagcca
gccgggtga

DBGET integrated database retrieval system