KEGG   Sorangium cellulosum So ce 56: sce9206Help
Entry
sce9206           CDS       T00634                                 

Gene name
thrC
Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:scl01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:scl00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:scl00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12824677..12826017
Genome map
AA seq 446 aa AA seqDB search
MAYSAAFRCLTGCAGSYPLTQPLYRCPTCGGLLDVAHDVDALRDRSPATWMKLFDERYKR
TVWPYGSGVWGKREWVAPEVPDEAIVSMDEGGSNLFWADRYGRTLGLDDVWVKLCGNSHT
GSFKDLGMTVLVSVVNKAIREGLEVRAIACASTGDTSASLAAYGAAAGLPVVVLLPRGKV
STAQLVQPIASGALVLSLDTDFDGCMAIVQRLSADGVVYLANSMNALRLEGQKTVAIEIV
QQFDWTLPDWVILPSGNLGNAYALYAGFKMLKDLGLTTRFPRLCVAQAARANPLFKAWSE
GRSEVVPMKAGETLASAIQIGNPVSAPRAMLALKAMDGVAEEVTEDELCDAAARADRTGM
YTCPHTAVALAALEKLVKKGLVEKRQRVVVVSTANGLKFTEFKVKYHERALADVTSRLAN
PPVELPPDYDRVLAALDRHAAQTGKR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcctactctgctgcattccgatgcctgaccggttgtgccggcagctacccgctgacg
cagcccctctaccgttgccccacctgcggcggcctgctcgacgtcgcccacgacgtcgac
gcgctccgtgaccggagccccgcgacgtggatgaagctcttcgacgagcgctacaagcgc
acggtgtggccctacggctccggggtctggggcaagcgggagtgggtcgcgcccgaggtc
ccggacgaggccatcgtgtcgatggacgagggcggctcgaacctgttctgggcggaccgc
tacggccgcacgctcgggctcgatgacgtctgggtgaagctctgcggcaacagccacacg
gggtcgttcaaggacctcggcatgacggtgctcgtctcggtggtgaacaaggcgatccgc
gagggcctcgaggtgcgcgcgatcgcgtgcgcgtcgacgggggacacctcggcgtcgctc
gcggcgtacggggcggctgccggcttgcccgtggtcgtgctgcttccgcggggcaaggtg
tcgacggcgcagctcgtccagccgatcgcgtcgggggcgctggtcctctcgctggacacc
gacttcgacggctgcatggccatcgtgcagcgcctctcggccgacggcgtcgtctacctg
gcgaactcgatgaacgccctgcggctcgagggccagaagaccgtggccatcgagatcgtg
cagcagttcgactggacgctgcccgactgggtcatcctcccgagcggcaacctcggcaac
gcctacgccctctacgcgggcttcaagatgctgaaggacctcggcctgacgacgcggttc
ccgcgcctctgcgtggcgcaggcggcgcgggccaacccgctcttcaaggcgtggtccgag
gggcggagcgaggtcgtgccgatgaaggcgggggagaccctggcgagcgcgatccagatc
ggcaacccggtgagcgcgccgagggcgatgctggccctcaaggcgatggacggcgtcgcg
gaggaggtcaccgaggacgagctctgcgacgcggcggcccgcgccgatcgcaccggcatg
tacacctgcccgcacacggcggtcgccctcgccgcgctggagaagctcgtgaagaagggc
ctcgtcgagaagcgccagcgggtcgtcgtggtctcgaccgcgaacggcctcaagttcacg
gagttcaaggtgaaataccacgagcgcgcgctcgcggacgtgacgagccggctcgccaac
ccgccggtcgagctgccgcccgactacgaccgcgtcctcgccgccctcgacaggcacgcc
gcgcagaccggcaagcgctga

DBGET integrated database retrieval system