KEGG   Schizophyllum commune: SCHCODRAFT_104477Help
Entry
SCHCODRAFT_104477 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
scm  Schizophyllum commune
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SCHCODRAFT_104477
  Replication and repair
   03420 Nucleotide excision repair
    SCHCODRAFT_104477
Transcription machinery [BR:scm03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SCHCODRAFT_104477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 355 aa AA seqDB search
MNPTHNSAQPTANGDPGPSSARGKPIYEGSTQFRNWRFSPERLAHTRARLNAGAVDAIRV
AFETDEPGSSSRVQFLTADEELLLVKLYASKIPQMCQLFRFPEEVEATAITYLKRFYLKN
TVMDWHPKNVMLTALFLATKTTNNPISIEHYTKVIPRVEVSDVLDIEFLVAQSLGFEFSV
WHAHRALWGIWLDLQTVPDAPPPDHNIYQKALSHVAQSRLTDAELIYTPSQIAHACLSLA
APNLAEQWLEAKFPSTSPEKAASATMLRDVIATLRALITTEGQAPPIEAVREVDRRLRLC
KNPEKIPGTKAYLARKAEEERKAEEKRQRKLKAATMGSDPFGETLVEEGLDDDDD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctacccacaatagcgcgcagcctacggcgaatggtgatccgggaccgtctagc
gcgcgcggaaagcccatatacgagggcagcacccaatttcgcaactggcgtttctccccc
gagcgtctcgcgcatacacgagcgcgtctgaatgcgggtgcggtggacgcgatacgcgtg
gcgttcgagacggacgagccaggctcatcgtctcgagtgcaattccttaccgcggacgag
gagctgctgctcgtcaagctttacgcgtccaagattccccaaatgtgccagctcttccga
tttccggaggaggtcgaagcgacggcgatcacctacttgaagcgcttctacctcaagaac
actgtgatggactggcatcccaagaacgtcatgctgaccgcactgttcctcgccacaaag
acgaccaacaaccccatttccatcgaacactacaccaaagtcattcctcgcgtcgaagtt
tccgacgtcctcgacatcgagttcctcgtggcgcaaagcctcggctttgagttctccgta
tggcacgcgcaccgcgcactgtggggtatctggctagacttgcagacggtaccggacgcg
cctcccccagaccacaacatctaccagaaagccctctctcatgtcgcacaatcccgcttg
accgacgcagagttgatatacacaccatcacaaatcgcgcacgcatgcctttccctcgca
gcacccaacctcgccgagcagtggttggaggccaagttcccctcgacctctccggagaaa
gctgcatctgctaccatgctacgtgatgtcatcgcaaccctccgggccctcatcacgact
gaggggcaagcaccgccgattgaggctgtccgggaggtagaccgtcgactacgactatgc
aaaaacccggagaagatacccggaacaaaggcctatctagcacggaaagcagaagaagaa
cggaaagcggaagaaaaacggcagcgaaagctcaaagcggcgaccatgggatcggaccct
ttcggcgagacattagtggaggaggggttagacgacgacgatgat

DBGET integrated database retrieval system