KEGG   Schizophyllum commune: SCHCODRAFT_104477Help
Entry
SCHCODRAFT_104477 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
scm  Schizophyllum commune
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:scm03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:scm03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 355 aa AA seqDB search
MNPTHNSAQPTANGDPGPSSARGKPIYEGSTQFRNWRFSPERLAHTRARLNAGAVDAIRV
AFETDEPGSSSRVQFLTADEELLLVKLYASKIPQMCQLFRFPEEVEATAITYLKRFYLKN
TVMDWHPKNVMLTALFLATKTTNNPISIEHYTKVIPRVEVSDVLDIEFLVAQSLGFEFSV
WHAHRALWGIWLDLQTVPDAPPPDHNIYQKALSHVAQSRLTDAELIYTPSQIAHACLSLA
APNLAEQWLEAKFPSTSPEKAASATMLRDVIATLRALITTEGQAPPIEAVREVDRRLRLC
KNPEKIPGTKAYLARKAEEERKAEEKRQRKLKAATMGSDPFGETLVEEGLDDDDD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctacccacaatagcgcgcagcctacggcgaatggtgatccgggaccgtctagc
gcgcgcggaaagcccatatacgagggcagcacccaatttcgcaactggcgtttctccccc
gagcgtctcgcgcatacacgagcgcgtctgaatgcgggtgcggtggacgcgatacgcgtg
gcgttcgagacggacgagccaggctcatcgtctcgagtgcaattccttaccgcggacgag
gagctgctgctcgtcaagctttacgcgtccaagattccccaaatgtgccagctcttccga
tttccggaggaggtcgaagcgacggcgatcacctacttgaagcgcttctacctcaagaac
actgtgatggactggcatcccaagaacgtcatgctgaccgcactgttcctcgccacaaag
acgaccaacaaccccatttccatcgaacactacaccaaagtcattcctcgcgtcgaagtt
tccgacgtcctcgacatcgagttcctcgtggcgcaaagcctcggctttgagttctccgta
tggcacgcgcaccgcgcactgtggggtatctggctagacttgcagacggtaccggacgcg
cctcccccagaccacaacatctaccagaaagccctctctcatgtcgcacaatcccgcttg
accgacgcagagttgatatacacaccatcacaaatcgcgcacgcatgcctttccctcgca
gcacccaacctcgccgagcagtggttggaggccaagttcccctcgacctctccggagaaa
gctgcatctgctaccatgctacgtgatgtcatcgcaaccctccgggccctcatcacgact
gaggggcaagcaccgccgattgaggctgtccgggaggtagaccgtcgactacgactatgc
aaaaacccggagaagatacccggaacaaaggcctatctagcacggaaagcagaagaagaa
cggaaagcggaagaaaaacggcagcgaaagctcaaagcggcgaccatgggatcggaccct
ttcggcgagacattagtggaggaggggttagacgacgacgatgat

DBGET integrated database retrieval system