KEGG   Schizophyllum commune: SCHCODRAFT_105253Help
Entry
SCHCODRAFT_105253 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
scm  Schizophyllum commune
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1338 aa AA seqDB search
MAPKRKRRDEQKGLAPGQVLKRAKLLGNASSPWGWVGTDVLDATHITDEHRLAACGFNQP
LCANKYAPEYRQMQKERQRRAKERKTREKRDSSPAGGADEVIVISDTEEAQPDCSKKLCN
KCNPNCLNYLGQDQWEDEDDAWEAFRKRVKLGDSPLDDARDPDLPVGLYNLGATCYANAS
LQVWFRDLAFRRGVYNCQPCGNESEDKFKQSPLFHLQVTFTALQESTQSVFNPNKLVESL
QLRTSEQQDAQEFSKLFMTHLASEFNKQSIPSVRSLVADQFEGVQLYGTRCDTCKTQSER
ESTFLEIEVNFGNNSRLEDCVASSLQPEKLTGDNKYACSACNALRDATRYTKLRKLPPVL
HFSLMRFVYDLKTYERKKSKSAIVFPTVLDMGRFVEGGGDASGSKAPAAANKESPTATGK
ESHIYDLRGVLLHKGSSAYHGHYEAQVYDTERACWFQFNDEIVTKITTLQEKNSKPIVVD
VEGEDEKPKKRPNVRKRRRVEDSEDEADLLSPTATSKAQLSATAAAKAQLKSTDITSKDA
YMLIYARRETPAILQASGGAVVPQANGGTTVTRANGSTAAMNGQTAGAANGAQVNGTVGF
AAGDAATSASASVAVGPKPTIANGNRAPTNGDGLSMNGSAADTASSTALTPPARAMEAVA
ALNAKHSEECERYLAKESEVKSAFRELRRKVMDIYQSWSVSRQDEPSVVVSSAALSEWLS
TYSATAEVRRLKPIVKAMKEENRAAQRADSVSGKVNGMDGETKGTPAKANGGVVSTSDTN
ADANGTKVGTNGNTGIEDDGATSSDAMDVDAKPSVNGEAESKPLDKGKQKAVDEPSDDGD
PNEIIHISIADDLLCEHGELHPSNSTSMKRIRKDAYDKIAAQTRCVFVPLLTPQDVCRQC
VEVIFKDRLYQVEHPRLVSQFDDIAEVPEGQPGYWISKPWVKDWRLTKPKMHRPDTGDPA
PDSDEFKDHVLCEHGRLINNIANRRRISLEAGNLLQALFPGLQLLPASEEPCAICAVAIH
SSKEGRLEARKKAEDEKARLKHMLDHALNGDTALLEDTPLAIVPSQFVRAWKMWLGRPTE
YPRPPGIDNSSFFCEHDQLAFDPNVPADMDSKLAVIKRSDWEVLQTLYPCGPLIALEKEA
KEKRYRHDIPVCVDCRQRRKSDWESTDITIRVGGPDKAKPTTTKKTYGSRQSKRLRSVKE
QGERRKMSVTKQTSIMGLKIMIQSELSIPTICQRLFYQGKELDDNKATMESLGIFANDTI
DLREEQEKDSFSDTEDGEHAAKRQRSEERGFGGTLLGAAVLPSSELPTPPPDMKSCPHCT
FFNAREAEVCETCDGALL
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaacgcaagcgccgcgacgagcagaagggtctcgcgcccggtcaggtcctc
aagcgcgccaagctcctcggcaacgcgtcctcgccctggggctgggtcggcaccgacgtc
ctcgatgcgacgcatatcactgatgagcataggctcgcggcgtgtggcttcaatcaacct
ctgtgcgcaaacaagtatgcgcctgagtacaggcagatgcagaaggaaaggcagaggagg
gcgaaggagcggaagacgagggagaagcgcgactcatcgcccgccggcggggcggacgag
gtgatcgtcatctcggacacggaggaggcccagccagactgctcgaagaagctctgcaac
aaatgcaatccgaattgcttgaactacttgggacaggaccagtgggaggatgaagatgac
gcttgggaggcgtttaggaagagggtcaagctaggagacagtccgcttgacgatgccaga
gatcctgaccttcctgttggactctacaaccttggcgccacatgctacgccaatgcttcc
ttgcaggtctggttccgtgaccttgccttccgacgcggtgtatacaattgccaaccctgc
ggaaacgagtccgaggacaagttcaagcaatctcccctcttccacctccaagttaccttc
actgcgctccaggagagcacacagagcgtgttcaatcccaacaagcttgtagagagcttg
cagctgcgcacgtcagagcagcaggatgcgcaagagttctccaagctcttcatgacgcac
ctcgcaagcgagttcaataagcagagtattccgtctgtgcggtcgcttgttgcggatcag
ttcgaaggtgttcaactctacggcacgcgctgcgacacatgcaagacgcagtccgagcgc
gagtcgaccttcttggagattgaggtcaacttcgggaacaacagtcgcctggaggactgt
gtcgcttcttcccttcaacccgagaagttgacgggagataataaatatgcctgctccgcc
tgcaacgccctccgcgacgccacccggtacaccaagctgcgcaagttgcccccggtactg
cacttctcgctcatgcgcttcgtgtacgatctgaagacgtacgagcggaagaagtcgaag
agcgcgatcgtgttcccgacggttttggatatgggaaggtttgtggagggtgggggcgat
gctagcggcagcaaggcgccggccgctgccaacaaagagtcgccgactgcaactggcaaa
gaatcgcacatctacgacctccgcggcgtgctgctgcacaagggctcgagcgcgtaccat
gggcactacgaggcgcaggtgtacgatacggaacgcgcttgctggttccaattcaacgac
gagatcgtgacgaagatcacgaccttgcaggagaagaacagcaagcctatcgtcgtcgat
gtggagggggaggatgagaaacccaagaagcgcccaaacgtgcgcaaacggcgacgcgtc
gaggatagcgaggacgaagctgacctgctcagccctaccgccacttcgaaggctcagctc
agcgcgactgccgctgcgaaggcccagctgaagagcacagacatcacctcgaaggacgcg
tacatgctcatatacgcccgtcgggagacgccggcaattcttcaggcgagtggaggcgct
gtggtgcctcaggcgaatggtggcaccactgtgactcgagcgaatggatccacggcggct
atgaacgggcagacggccggtgccgctaatggcgctcaggtgaacggtacggtgggcttt
gcagcgggggacgcggcgaccagtgcgagtgcgtctgtcgcggtcggtccgaagccgacc
attgcgaacggcaacagagcgccaacgaacggcgacggcctgtctatgaacggcagcgcg
gctgataccgcatcttccaccgccctcaccccgccggcacgcgccatggaagctgtggct
gccctgaatgcgaagcacagcgaggagtgcgagaggtatctggcgaaagagtccgaagtt
aagtcggcctttcgtgagctgcggcgcaaggtgatggacatctatcagagttggagtgtg
agcaggcaagatgagccatccgttgtggtcagctcagccgcgctttccgagtggttgtcg
acgtatagcgcgacggccgaggtccggaggctgaagccaattgtgaaggcgatgaaagag
gagaatcgtgcggcgcaaagagcagactcagtgagcgggaaagtcaatggaatggatggc
gagacgaagggtacacccgccaaggcgaacggcggggtggtcagcacgagcgacacgaac
gccgacgcgaatggcacgaaagtcggcacgaatggcaacaccggtattgaggacgacggc
gcaaccagttcggatgcgatggacgtagacgccaaaccgtcagtcaatggcgaggccgag
tcgaaaccattggacaagggcaagcagaaggccgtggatgagccgtccgacgacggagat
cccaacgaaataatccacatatccatcgcggacgacctcctttgtgagcatggcgagctg
catccatcgaactcgacgtcgatgaagcgtatacggaaagacgcctatgacaagatcgct
gcgcagacgagatgcgtcttcgtgccgctcttgactccgcaggatgtatgtcggcagtgc
gttgaggtgatcttcaaagatcgcctatatcaggtggagcatccacgccttgtcagtcaa
ttcgatgatatcgctgaggtaccggaaggccaaccgggctactggatatcgaagccttgg
gtgaaggactggcgattaacaaagccgaagatgcaccgaccagacactggcgacccggcg
cctgactcggacgagttcaaagatcatgttctttgcgagcacggtcgattgattaacaat
atcgccaatcgtaggcgaatatcgctggaggcaggcaatttactccaagccttgtttcct
gggctgcagcttctcccagcgtcggaagagccctgcgcgatctgcgccgttgccatacat
tcatcgaaggaaggccgattggaggcgcggaagaaggcagaagatgaaaaggctcgactc
aagcacatgctcgaccatgccttgaatggagataccgctttgctggaagatacgccgctc
gcaattgtgccctcccagttcgtccgcgcttggaaaatgtggctcggccgcccaacggaa
taccctcgaccaccgggtatcgacaactcgtcgttcttttgcgaacacgatcagctcgca
ttcgatccgaacgtccccgccgacatggactcgaagttagcggtgatcaagcggagcgat
tgggaggtgctgcagacattatatccctgcggacctctgatagctctggagaaagaggcg
aaggagaagagatatcggcacgatatcccagtttgtgtggactgtcggcaaagaaggaaa
tccgattgggagtcgacggatatcactatccgggttggcggcccggacaaggcgaagccg
acaacgacaaagaagacgtacggctctcgccagtcgaagcgcctgcgctccgtgaaggaa
cagggcgagcggcgaaagatgtcagtcaccaagcagacatccatcatggggctcaagatc
atgatccaatcggaattgtctatacccacaatttgccagcgactcttctatcagggcaag
gaactcgatgacaacaaggcaacgatggagtcgctgggcatctttgccaacgatacgatc
gacttgcgagaggagcaggagaaggattcgttctcggatacggaggatggtgaacatgcc
gcgaagcgccaacgctcagaggagcggggctttggagggactttactaggtgcagctgtg
ctaccctcatccgaacttcctaccccaccaccagatatgaagtcctgtccacactgtacg
tttttcaatgcgcgtgaagccgaggtctgcgagacctgcgacggcgccctcctg

DBGET integrated database retrieval system