KEGG   Schizophyllum commune: SCHCODRAFT_105969Help
Entry
SCHCODRAFT_105969 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
scm  Schizophyllum commune
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SCHCODRAFT_105969
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     SCHCODRAFT_105969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 696 aa AA seqDB search
MVHRDIVIRLHGKTATLAFTDSALTVARGAATDTSSARSARSSDSASRSKSDVEVPLRNV
LGAEFDEKTREIVIHFVSRKKKNGKGPHVLVKITGAVKDAENYTAKLWVDNLLQSVFTSS
GVTNGRKLKVLVNPHGGQGKGLVVWRKRIEPIFKAAGCQIDLTITTHNGHAYDLAKTLAL
DYDAVVTVSGDGLIHEVLNGFAAHEQPTKALSIPIAPIPTGSGNGMALNLLGLADGFDVV
AAALNAIRGHPMPVDLFSIVQEGKRSVSFMSQALGLMADLDLGTEHLRWMGDARFVYGFI
RGVLSQKPCPIELYYKPAETDRQKMYKALQDRHATQATHQAHASTASVSFAVRPSSPFSS
PATPFASSTPFSGGPANSFSGPASPTSASTPSDRRPKSPMSEDGEDGLPPLVYAKSGGGS
ESGEDGWTKFEDPILFVYAGKGPYVARDMMAFPASLPDDGLIDVTIHPMAPMGELLGALN
GADKGDLFWRKRLTYLKAHAFHVRPVAPAPNREPQGNLSVDGERFPFKEFTVEVHQKLGR
LMSMHGMYVSDFGKEGASGKGKDAAKATTAGKPDDVAKGKAPTNGVALAPPPAGKLAKTA
QAPVAEAAVAAPKEVTETGVAPEVTNGTAKDVEATPATDVATHEPATGVVTHELAKEAEE
PKAGIPVEKADETTCRAAPNGDAPASSATAQVAEEH
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaccgcgacatcgtcatccgcctccatggcaagacggccacgctggccttcact
gacagcgcgctcaccgtcgcgcgcggcgccgccacggacacctcgtccgcccgctccgcc
aggtccagcgactccgcctcccggtccaagtccgacgtcgaggtgccgctgaggaacgtg
ctcggcgcggagttcgacgagaagacgcgggagatcgtgatacactttgtgtcgcggaag
aagaagaacggcaagggcccgcatgtgctggtgaagatcaccggtgcggtcaaggatgcg
gagaactacaccgcgaagctttgggtggacaacctgctgcagagcgtctttacttcgtct
ggagtgacgaacggaaggaagctgaaggttttggtcaaccctcacggaggacagggcaaa
ggtcttgtcgtctggcgtaagagaatagaacccatcttcaaggcagcaggctgtcagatc
gacctcactatcaccacccacaacgggcacgcgtacgatctcgcgaagaccctcgcgctc
gactacgatgctgtagtcaccgtttccggggacggtcttattcatgaggtcctgaacggc
ttcgcggcgcatgagcagcccaccaaagccctttcaatccccattgcgcccatccctacc
ggctcggggaatggcatggccctcaacctgcttggtctggcggacggcttcgacgtggtt
gcggcagccctgaatgctatcagaggccatcctatgccagtcgacctattctccatcgta
caggaaggcaaacgctctgtgtcgttcatgtcgcaggctttaggcctcatggccgacctc
gacctcggcacagagcacctgcgctggatgggtgatgctcggttcgtctacggcttcatc
cgtggcgtcctctcgcagaaaccctgtccgattgagctgtactacaagcccgcggagacc
gaccgccagaagatgtacaaggcgctccaggaccggcacgccacgcaggcgacgcaccag
gcgcacgcctcgacggcgtccgtgtccttcgccgtcaggccctcatcgccgttctcctct
cccgcgacccccttcgcgagctcgacgccgttctcgggcggtccggcgaactcgttttcg
ggccccgcgagcccgacgtcggcgtctacgccctctgatcggaggcctaagtcaccgatg
tcggaggatggggaggacgggctgccgccgttggtgtatgcgaagtccggcggtggcagc
gagagtggcgaagacggctggacgaagttcgaggacccgatcctgtttgtgtatgcgggg
aagggaccgtatgtggcgcgcgacatgatggcgttcccggcgtcgctgccagacgatggg
ttgattgacgtaacgattcatcctatggcgcccatgggcgagctacttggtgcgctgaac
ggcgcggataagggtgacttgttctggaggaagaggctcacctacctcaaagcgcacgcc
ttccacgtccgccccgtcgcccccgcgcccaaccgcgagccgcagggcaacctgtccgtc
gacggcgagcgcttcccgttcaaggagttcacggtcgaggtgcaccagaaattgggccgg
ctgatgagcatgcacggcatgtatgtgagcgattttgggaaggagggggcgagtgggaag
gggaaggatgctgctaaagccaccaccgcggggaagccggacgacgtcgcgaagggcaag
gcaccaacgaacggtgtcgccctcgctcctcctccggcggggaagctcgcgaaaactgcc
caggcgcccgtcgcggaggcggctgtggctgccccgaaggaggtgacagagaccggagtt
gcccccgaggtcacgaatggcaccgcaaaggatgtggaggcgacaccagcgacggatgta
gccacccacgagccagcgacaggtgtagtcacccacgagctggcgaaggaagctgaagag
ccgaaagccggaatccccgtcgaaaaggcggacgagacgacttgcagggctgcacccaat
ggagatgcgcctgcgtcctccgcgactgcgcaagttgcggaagagcac

DBGET integrated database retrieval system