KEGG   Schizophyllum commune: SCHCODRAFT_106001Help
Entry
SCHCODRAFT_106001 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
scm  Schizophyllum commune
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SCHCODRAFT_106001
   03420 Nucleotide excision repair
    SCHCODRAFT_106001
   03430 Mismatch repair
    SCHCODRAFT_106001
   03440 Homologous recombination
    SCHCODRAFT_106001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 306 aa AA seqDB search
MSQSPYAGGGYYGSQGGGGYVQGSSPFGGSQASPSAQKSEASHSIRACTIGQLTRATQVH
TDAPFTVGGFELGHVTIVGHVKSLRDQATNTVIIINDGSGELEARLWADAGQSPSDSYGG
VHEGGIARVTGSLKVFGAKKYINAACVRPVEHNERVFHHFEVMYSTIRLERGAPPGTKAA
EHAPAGAFASSTSGGGASAYLAPSSKPVGSGGKKSLKEEITDYMRQHKTEDGVSVKDIAQ
ALSSSNAKQISEALDQLLDEGNVYTTTDGSTFALLTCATPSAYWHSVSPSLDSATLLELL
ASHARA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatcaccctacgctggcggcggatattatggatcgcagggaggcggcggctat
gtgcaaggcagctcgccatttggtggcagtcaggccagcccaagtgcgcagaagagcgaa
gcctcccactccatccgcgcatgcaccatcggccagcttacgcgcgcaacacaagtacat
accgacgcgccattcactgtcggcggcttcgagctcggacatgtcaccatcgttggccac
gtcaaaagcctgagggaccaggcaacaaatactgtgatcatcataaacgacggctcgggg
gaacttgaggcgcgcctatgggcagatgctggacagtcaccgtcggacagctatgggggt
gtgcacgagggcggcatagcacgcgtcactggctcactaaaggtcttcggcgcgaagaaa
tacatcaacgcagcctgcgtgcgccccgtcgagcacaacgaacgcgtcttccaccacttc
gaggtcatgtactcgacaatacgactcgagcgcggggcacctccgggaaccaaggccgcc
gaacacgctccagccggcgcatttgcatcgagcaccagcggcggcggggcctccgcctac
ctcgccccatcctcaaaacccgtcggcagtggcgggaagaagagcctcaaggaggagatc
acggactacatgaggcaacacaagactgaggacggtgtgtcggtgaaggacatcgcgcag
gcgctgtcttcgtcgaatgcgaaacagatcagtgaggcgttggaccagttgttggacgag
ggcaatgtgtacacgacgacagatgggtcgacttttgctctgctgacatgcgcgacacct
tcagcatactggcattcggtctcaccttctcttgattcggccactctcttggagctgctc
gcatctcatgctcgcgca

DBGET integrated database retrieval system