KEGG   Schizophyllum commune: SCHCODRAFT_107945Help
Entry
SCHCODRAFT_107945 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
scm  Schizophyllum commune
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCHCODRAFT_107945
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SCHCODRAFT_107945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 334 aa AA seqDB search
MPLCAIRGSVNCDEYFNVKSIGRPGETISSFGYTKGIGGKGANQALAVARAGGATKNDVH
FVGAVGSDGKWIREQLSAWGINVDHLANTGDAPPTGRALIQVAEDGENSILLFPGANFDE
SYEDKTPSASYLPAGTTHLLLQNEITLRSTLTALAAAKASPITPVVTVFNPSPMPLPDQL
KSFPWHQIDWLLINQGEGQELYSILHGKKETGSVEALLKDLTDLPTLSKTNIICTLGGDG
LAACVLEAGKRRIIRLPAAKITEIRDTTGAGDTFTGYFVRGLMELEEAKVAAEGDALEKA
LTRAIQAAGMCVEKKGTVASIPLRDDVEKRLAVA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcctctttgtgctattcgcggttccgtcaactgcgatgaatatttcaatgtgaagtcc
atcggccgtccaggcgagactatctcctccttcggctacaccaaaggcatcggtggcaag
ggcgcgaaccaggctctcgcagtcgcgcgcgctggcggcgcgaccaagaacgacgtccac
ttcgtcggcgctgtgggctccgatggcaaatggatccgtgagcagctcagcgcgtggggc
atcaacgtcgatcatctcgcgaacacgggggacgcgccccccacggggcgcgcgctgatc
caggtcgcggaggatggggagaattcgatattgctcttccccggggcgaacttcgacgag
tcttacgaggacaagacgccttcggcatcctacttgcccgccgggaccacacacctcttg
ctacagaacgagatcacgcttcggagcaccctcaccgcgcttgctgctgcgaaggcgagc
ccaatcacgccagtagtcacagttttcaacccttcgcccatgccgctccccgaccagctg
aagtccttcccctggcaccaaatcgactggctcctcatcaaccagggcgaagggcaggag
ctgtactccatcctccatgggaagaaggagactggctccgttgaggcattgctcaaagac
ctcaccgaccttccaactttgtcgaagacgaacatcatctgcaccctcggtggcgatggc
ttggctgcgtgcgttctggaagctggcaagcggagaataatccgcctccctgctgcgaag
atcacggagattcgagataccactggagcgggtgacacgttcacgggatactttgtgcga
ggtttgatggagctggaggaggcgaaggtagcggcagagggggacgcgctggaaaaggcc
ttgacgcgcgcgattcaagcggcagggatgtgcgttgagaaaaaggggactgtcgccagc
ataccattacgagatgatgtggagaagaggctagcggtagca

DBGET integrated database retrieval system