KEGG   Schizophyllum commune: SCHCODRAFT_108383Help
Entry
SCHCODRAFT_108383 CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K03505  DNA polymerase delta subunit 4
Organism
scm  Schizophyllum commune
Pathway
scm00230  Purine metabolism
scm00240  Pyrimidine metabolism
scm01100  Metabolic pathways
scm03030  DNA replication
scm03410  Base excision repair
scm03420  Nucleotide excision repair
scm03430  Mismatch repair
scm03440  Homologous recombination
Module
scm_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCHCODRAFT_108383
   00240 Pyrimidine metabolism
    SCHCODRAFT_108383
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SCHCODRAFT_108383
   03410 Base excision repair
    SCHCODRAFT_108383
   03420 Nucleotide excision repair
    SCHCODRAFT_108383
   03430 Mismatch repair
    SCHCODRAFT_108383
   03440 Homologous recombination
    SCHCODRAFT_108383
DNA replication proteins [BR:scm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    SCHCODRAFT_108383
DNA repair and recombination proteins [BR:scm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      SCHCODRAFT_108383
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     SCHCODRAFT_108383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4 SR-25
Motif
Other DBs
NCBI-GeneID: 9591025
NCBI-ProteinID: XP_003033475
JGI: Schco1_108383
UniProt: D8Q1W0
Position
Unknown
AA seq 204 aa AA seqDB search
MPPTRTTRSSGAPKLKQAKLSFNASKRGASANTAKPAKTSVARTSSTPVLSRRASSSSSS
ISADSSSSDHTDDEDDIEVVEAPRKSTRRLPLAKAVIDVDAEAEPLDVKDPRWNRAHKEA
KELRGTPLVHAEGQNKVHDILRVFDMTYKYGPYVGVTRLERWERANNLGLNPPPEIRDIL
LTREGRTLDEYAQSAVFGKGDVLH
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgccccccactcgcaccaccagatcctctggagctcccaagctcaagcaagcgaagctg
agcttcaacgcctccaagcgtggcgcatctgcgaacaccgcaaagcccgccaagacctcc
gtcgctcgcaccagctctacccccgtcctctctaggcgggcctcctcttccagctcaagc
atcagtgccgacagcagtagcagcgatcatacagacgatgaagatgacattgaggttgtg
gaggctcctcgcaagtcgacgaggcgactacccctagccaaagctgtcatagacgtcgat
gctgaggccgagcctctcgacgtgaaggacccacggtggaaccgagctcacaaggaagcg
aaagagctgcgcggcacaccgctcgttcacgccgaagggcagaacaaggtgcacgatatc
ttgagggtcttcgatatgacctataagtacggcccgtacgtcggcgtcacccgcctagag
cgctgggagcgcgctaataaccttggtctcaatccccctcccgagattcgagacatcctg
ctcactcgcgagggcagaacactcgacgaatatgctcagagcgccgtcttcggcaagggc
gatgtgctgcat

DBGET integrated database retrieval system