KEGG   Schizophyllum commune: SCHCODRAFT_108383Help
Entry
SCHCODRAFT_108383 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
scm  Schizophyllum commune
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCHCODRAFT_108383
   00240 Pyrimidine metabolism
    SCHCODRAFT_108383
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SCHCODRAFT_108383
   03410 Base excision repair
    SCHCODRAFT_108383
   03420 Nucleotide excision repair
    SCHCODRAFT_108383
   03430 Mismatch repair
    SCHCODRAFT_108383
   03440 Homologous recombination
    SCHCODRAFT_108383
DNA repair and recombination proteins [BR:scm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      SCHCODRAFT_108383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 204 aa AA seqDB search
MPPTRTTRSSGAPKLKQAKLSFNASKRGASANTAKPAKTSVARTSSTPVLSRRASSSSSS
ISADSSSSDHTDDEDDIEVVEAPRKSTRRLPLAKAVIDVDAEAEPLDVKDPRWNRAHKEA
KELRGTPLVHAEGQNKVHDILRVFDMTYKYGPYVGVTRLERWERANNLGLNPPPEIRDIL
LTREGRTLDEYAQSAVFGKGDVLH
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgccccccactcgcaccaccagatcctctggagctcccaagctcaagcaagcgaagctg
agcttcaacgcctccaagcgtggcgcatctgcgaacaccgcaaagcccgccaagacctcc
gtcgctcgcaccagctctacccccgtcctctctaggcgggcctcctcttccagctcaagc
atcagtgccgacagcagtagcagcgatcatacagacgatgaagatgacattgaggttgtg
gaggctcctcgcaagtcgacgaggcgactacccctagccaaagctgtcatagacgtcgat
gctgaggccgagcctctcgacgtgaaggacccacggtggaaccgagctcacaaggaagcg
aaagagctgcgcggcacaccgctcgttcacgccgaagggcagaacaaggtgcacgatatc
ttgagggtcttcgatatgacctataagtacggcccgtacgtcggcgtcacccgcctagag
cgctgggagcgcgctaataaccttggtctcaatccccctcccgagattcgagacatcctg
ctcactcgcgagggcagaacactcgacgaatatgctcagagcgccgtcttcggcaagggc
gatgtgctgcat

DBGET integrated database retrieval system