KEGG   Schizophyllum commune: SCHCODRAFT_110065Help
Entry
SCHCODRAFT_110065 CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
scm  Schizophyllum commune
Pathway
scm00010  Glycolysis / Gluconeogenesis
scm00071  Fatty acid degradation
scm00350  Tyrosine metabolism
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCHCODRAFT_110065
  Lipid metabolism
   00071 Fatty acid degradation
    SCHCODRAFT_110065
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCHCODRAFT_110065
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SCHCODRAFT_110065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C ACP_syn_III_C OCD_Mu_crystall
Motif
Other DBs
NCBI-GeneID: 9592605
NCBI-ProteinID: XP_003031491
JGI: Schco1_110065
UniProt: D8Q673
Position
Unknown
AA seq 348 aa AA seqDB search
MGAPETMVAYLYKPGFDDLIRVDDYPVQKPGKGEVLCKVLVCGVCHSDVAILNGYTADSR
TYVLGHEVCATPIVLGENVDPSIKIGHRYAIQLINGCTHALKPHQAAALQGVGLGGPGGY
ADYITVPDNLLVPVPDNVPDKVAAIAADAGTTAYNAVVNTGQVKAGDRVLIIGVGGLGHL
AVQYAILQGAEVYVCDLKPEARRLGLELGAVKAFSLVELSAAVSAPDPFTVHAVIDFAVS
AQTFTLGLSALVGEGDHYPTDPRYVLVGVSGDNLVFTSGEALFSAIQIRANLYGPRSATE
AALELFANGSVKARVTAEPIENVNKIIDELRAYEVSGRKVLQINELEY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcccccgagaccatggtcgcatacctctacaaacccggcttcgacgacctcatc
cgcgttgacgactaccccgtccagaagcccggcaagggagaggtcctctgcaaggtcctt
gtctgtggtgtatgccactctgacgtcgccatcctcaacggatacaccgcagacagccgg
acctacgtgctggggcatgaagtgtgtgcgacgccgattgtcctcggcgaaaacgtcgac
cccagcatcaagatcggtcaccgctacgccatccagctcatcaacggctgcacgcacgcg
ctgaagccccaccaggccgccgcgcttcagggcgtcggtctgggaggcccgggcgggtac
gcggactacattactgtgccggataacttgttggtgccggtgccagacaacgtgcccgac
aaggtcgccgccatcgcggcggacgcggggacgacggcgtacaacgctgtcgtgaacacg
ggccaggtcaaggcgggcgacagggtgctcatcattggcgtcggcggtctgggtcatttg
gccgtgcagtatgcgattctgcagggcgcggaagtctacgtctgcgacctcaagcccgaa
gcccggcgcctcggcctcgagctcggggccgtgaaggcattctcgctcgtcgagctgagc
gcggcggtcagcgcgcccgatccgtttacggtgcatgcggtgatcgactttgcggtgtca
gcgcagaccttcactctgggcctgagcgccctcgtcggcgaaggagaccactacccgacg
gatccgcgatatgttttggtcggcgtctccggcgacaacctcgtcttcacgtcgggcgag
gcgctgttcagtgcgattcagatccgcgccaatctctacggcccccgtagtgcgaccgag
gctgcgctggagctgtttgccaacggctccgtgaaggcgcgcgtcaccgccgagcctatc
gagaacgtgaacaagatcattgacgagctgcgcgcgtacgaagtcagcgggaggaaggtg
ttgcagatcaatgagttggagtat

DBGET integrated database retrieval system