KEGG   Schizophyllum commune: SCHCODRAFT_111676Help
Entry
SCHCODRAFT_111676 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
scm  Schizophyllum commune
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SCHCODRAFT_111676
Enzymes [BR:scm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     SCHCODRAFT_111676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1059 aa AA seqDB search
MPAFQNPVVPSKRKSEAADGPAAKRRQSEIGSSSTEEYWVVQWRNPQTRKHKTWDEDGVL
QVVGSKATLYDMDGKAVGFGRADLPLSSGKNFSVGGKDLELDRELTKRDFLSGSCFGSST
FSVSTPVEASPIRTSHSAYKAFKPPTIGKSFAQPSRGIPLQPVSLLATSQSSSQVRNDDT
SSDQKDGIWSVAWRKPVNNKNKQTWDGDAYAEKSDDKLTLISEEGKIMGSTSCKGHLLSE
GYRMYIGGKEVRFDAVMPRSQLPDAVRERLKDAGDDEDDVEVVAAPTLPVVKPQPMKPIA
AANFYGAPPKSKEPKPLHDPAAEGAIVMKAPTKDHIKKFNKKGLPVVPVVIDPVLGRRLR
PHQVEGVKFLYECVMGLRKHEGQGCILADEMGLGKTLQVGCMRISLLLHLTVLCEDDHPR
MDAAETKSVLRAHASGTEGLDRMPSIPGEQHTKNWKSEFHKWLGRDRVGVTVCDNSNKGL
QTFLHGGKHQHVLIIGYERLRTVVNKITTCIPPVGLIICDEGHRLKSANNKTTTMFKALK
TPRRVILSGTPIQNDLSEFHAMADFCNPGLLDDYQTFRRVYEIPIVKSRTPEATPKELEI
GEGRLAQLLTISNSFVLRRDAGLLGNYLPPKHEHIVFVKPTQLQISMYQKILHPDKVDDF
VNGSQADTLALLNTLKKVSNSPILVKAAHDKDKESSRTSIAKSAVADAVTVLQPDARVDD
MTLSGKLILVSKLLKYIYEHTDEKVVFVSHYTSSLNILSAYCDRKRYKYNRLDGNTPPAK
RQEYVNQFNKSTQRSNFIFLLSGVGINLTGASRLILFDCDWNPSYDLQSAARCHRDGQKR
PVHVYRFMTAGLIDEKIYQRQVTKLGLSSSLMGSESSKDKSDSFTRKDLRDIFRVYADTG
CNTHDLLDCSCEADMPPASPEDEGSPDEDESEEEDGEERKGFLPASQVKPKDISKADKAD
LQKKKAALAALGEFKHINCLGPGAENMSDGVLRSLLYRPPPTEASAPKSQLETLLSLDLA
TIDAMDASKKFQSLPGGTITYVFEKTASTTPEDVPMKEA
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctttccagaatccagtcgtgcccagcaaacggaaatccgaagccgcagacgga
cctgcggcaaagagacgacagtcagagatcgggtcgagctcgacagaggagtattgggtg
gttcaatggagaaaccctcagacgaggaagcacaagacatgggacgaagacggagtcctc
caggtagttgggagcaaggccaccctgtatgatatggacgggaaagctgtgggcttcgga
cgagccgacttgcctctgtcatctggcaagaacttctctgtcggcggcaaggacctcgag
ctcgacagggagctaaccaagagggacttcctgtccggctcctgcttcggcagctccacc
ttctcggtgtcgactcccgtcgaggcatcacccatccgaacatcacactctgcatacaag
gccttcaagccacctaccattggcaagtcattcgcgcagccatcgcggggcattccccta
cagcctgtcagcttgctggcgacctcgcaatcctcctcgcaggtgcgaaatgatgatact
tcctcggaccagaaggatgggatctggtccgttgcatggcggaagcccgtcaacaataag
aataagcagacgtgggatggggacgcatacgccgagaagtccgacgacaagctcacgctc
atctccgaggaggggaagataatgggctccacatcctgcaaagggcatctcctgtctgaa
ggctaccgcatgtacattggcggaaaggaagtgcgcttcgatgccgtgatgcctcgctcg
cagctcccggacgccgtacgtgagcgcctcaaggacgccggggatgatgaggacgatgtg
gaagtcgttgctgcgccgacgctgcctgtcgtgaagccgcagccgatgaagccgattgcg
gcggcgaatttctatggcgcgccgccgaagtcaaaggagccgaagccgttacacgatccg
gcggcggaaggagcgattgtgatgaaggcgccgacaaaggaccatatcaagaagttcaac
aagaagggtttgcctgtcgttccggtcgtcattgatcctgtgctcggccgtaggcttcgg
cctcatcaagttgagggggtgaagttcctgtacgagtgcgtcatgggcctgcggaagcac
gaggggcaaggctgcatccttgcagatgagatgggtctcgggaagactttgcaggtgggg
tgtatgcgcatctccctcttgcttcatctgacggtgctttgcgaagacgatcaccctcgt
atggacgctgctgaaacaaaatccgttcttcgggcccacgccagcggtacagaaggtctt
gatcgtatgcccagtatccctggtgaacaacacacgaagaactggaagtccgagttccac
aaatggctcgggcgcgatcgcgtgggtgtgacggtttgcgacaacagcaacaagggattg
cagacgttcttgcatggagggaagcaccagcacgtcttgatcatcggttatgagcgactg
cggaccgtcgtcaacaagatcacgacgtgcatccctcctgtcgggctcattatatgcgac
gaagggcaccgactgaagtcagcgaacaacaagacgactaccatgttcaaggcgctcaag
acgccgagacgtgtgatcctgtccgggacgcctatccagaacgatctgagcgagttccac
gccatggctgacttctgtaatccgggtttgctggacgactaccagaccttccgtcgcgtg
tatgagatacccatcgtcaagagccgaaccccggaggcgaccccaaaggagctcgaaatt
ggcgaagggcggctcgctcagctgctcaccatctcgaacagcttcgtcctacgcagggat
gccggcttgcttggcaattacctgcctcccaagcatgaacacattgtcttcgtcaaaccg
acccagctgcaaatttccatgtaccagaagatcctgcacccggacaaggtcgatgacttc
gtgaacgggtcgcaggcggatacgttggcgttgttgaacaccttgaagaaggtgtcgaat
agtccgatccttgtgaaggcggcgcatgataaggataaggagagctcgaggactagtatt
gcgaagagtgcggtggcggatgcggtgacggttctgcagccggacgcgagggtggacgat
atgactttgagtggcaagctgatcctggtgtcgaagctgttgaagtacatctatgagcac
acggacgagaaagtcgtcttcgtgtcccattatacttcttcactcaacatcctgtcggcc
tactgcgaccgcaagcgatacaagtacaaccgtctggatggcaataccccgcctgctaag
cgccaggaatacgtcaaccagttcaacaagtctacgcagaggagcaacttcatcttcctg
ctgagtggtgtcggaatcaaccttacgggtgcctcgaggctcatcttgttcgattgtgac
tggaatcctagttacgacttgcagtctgcagctcgttgtcatcgcgatggtcagaagcgg
cctgtgcacgtctaccgtttcatgacggctggcctcatagatgagaagatctaccagcgt
caggtcacgaagttgggactaagcagttctctcatgggatcggagtcgtccaaggacaag
agcgactcgttcacgcggaaagaccttcgcgatatcttccgcgtctacgccgacaccggc
tgcaatacgcatgaccttctggactgctcgtgcgaggcagacatgccaccagcttctccc
gaagacgaagggtccccggatgaggacgagtccgaggaagaagacggcgaggagcggaag
gggttcctacctgcctcgcaggttaaacccaaagacatcagcaaggccgacaaagcggac
ctgcagaagaagaaggctgccctggcggccttgggagagttcaagcatatcaactgcttg
ggccccggcgctgagaacatgtcggacggcgtgttgcgaagcttgctgtaccggccacct
ccgacggaagcctcggcacccaaatctcagctggagactttgctgtccctcgatctcgcc
acgattgacgcgatggatgctagcaagaagttccaatcgcttcccgggggtacaattact
tacgtcttcgagaagactgcatcgacgacgccggaggacgtgccgatgaaggaggcc

DBGET integrated database retrieval system