KEGG   Schizophyllum commune: SCHCODRAFT_12169Help
Entry
SCHCODRAFT_12169  CDS       T01331                                 

Definition
serine/threonine-protein phosphatase PP1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
scm  Schizophyllum commune
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:scm03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:scm04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 331 aa AA seqDB search
MADAQTEIDLDSVIDRLLEVRGNRPGKPVQLQEYEIKYLCTKAREIFINQPILLELEAPI
KICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFF
ILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPD
LQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKH
DMDLICRAHQVVEDGYEFFAKRHLVTLFSAPNYCGEFDNAGAMMSVDETLLCSFQILKPA
EKKAKYPYGGMNMGRPVTPPRKQKKKDSKMG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgcgcagacggagatcgatcttgactcggtcattgaccggctattggaagtg
cgcggtaaccgtcccgggaagcccgtgcagcttcaggagtacgagatcaagtacctgtgc
acgaaggcgcgcgagattttcatcaaccaacccattttgctcgagctggaggcacccata
aaaatctgcggtgacattcacggacaatactacgacctgctacgtctatttgagtatggc
gggtttccgccagaagccaactacctcttcctcggtgactacgtcgatcgaggaaagcaa
tcgctggagacgatctgtttgctgctggcatacaagatcaagtacccggagaacttcttc
atcctgcgcggaaaccacgagtgtgccagtatcaacagaatatacgggttctacgacgaa
tgcaagcgccggtacaacatcaagttgtggaagacgtttacggactgcttcaactgcttg
ccgatcgctgccatcatcgacgaaaagatcttcacgatgcacggcgggctcagcccagac
ttgcagtcgatggagcagatacgaagagtgatgaggccgacggacgtgccggacactggt
ctgctctgcgatctgctatggtccgatcccgacaaggacattacgggctggtcggaaaac
gaccgcggcgtgtcctttacgtttggcccggacgtcgtgtccagattcttgcaaaagcac
gacatggacctgatctgccgagcgcatcaggtcgtcgaggatggctacgagttcttcgcc
aagcggcatctcgtgaccctcttctccgcacccaattattgtggcgagttcgacaacgcg
ggtgcgatgatgagtgtggacgagaccttgctgtgctccttccagattctcaaaccggcg
gagaagaaggcgaagtacccatacggtggcatgaatatggggcgcccagtaacgccgccg
cgcaagcagaagaagaaggacagcaagatgggctaa

DBGET integrated database retrieval system