KEGG   Schizophyllum commune: SCHCODRAFT_12169Help
Entry
SCHCODRAFT_12169  CDS       T01331                                 

Definition
serine/threonine-protein phosphatase PP1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
scm  Schizophyllum commune
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    SCHCODRAFT_12169
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    SCHCODRAFT_12169
Enzymes [BR:scm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     SCHCODRAFT_12169
Protein phosphatases and associated proteins [BR:scm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     SCHCODRAFT_12169
Transcription machinery [BR:scm03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     SCHCODRAFT_12169
Messenger RNA biogenesis [BR:scm03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     SCHCODRAFT_12169
Spliceosome [BR:scm03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    SCHCODRAFT_12169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 331 aa AA seqDB search
MADAQTEIDLDSVIDRLLEVRGNRPGKPVQLQEYEIKYLCTKAREIFINQPILLELEAPI
KICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFF
ILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPD
LQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKH
DMDLICRAHQVVEDGYEFFAKRHLVTLFSAPNYCGEFDNAGAMMSVDETLLCSFQILKPA
EKKAKYPYGGMNMGRPVTPPRKQKKKDSKMG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgcgcagacggagatcgatcttgactcggtcattgaccggctattggaagtg
cgcggtaaccgtcccgggaagcccgtgcagcttcaggagtacgagatcaagtacctgtgc
acgaaggcgcgcgagattttcatcaaccaacccattttgctcgagctggaggcacccata
aaaatctgcggtgacattcacggacaatactacgacctgctacgtctatttgagtatggc
gggtttccgccagaagccaactacctcttcctcggtgactacgtcgatcgaggaaagcaa
tcgctggagacgatctgtttgctgctggcatacaagatcaagtacccggagaacttcttc
atcctgcgcggaaaccacgagtgtgccagtatcaacagaatatacgggttctacgacgaa
tgcaagcgccggtacaacatcaagttgtggaagacgtttacggactgcttcaactgcttg
ccgatcgctgccatcatcgacgaaaagatcttcacgatgcacggcgggctcagcccagac
ttgcagtcgatggagcagatacgaagagtgatgaggccgacggacgtgccggacactggt
ctgctctgcgatctgctatggtccgatcccgacaaggacattacgggctggtcggaaaac
gaccgcggcgtgtcctttacgtttggcccggacgtcgtgtccagattcttgcaaaagcac
gacatggacctgatctgccgagcgcatcaggtcgtcgaggatggctacgagttcttcgcc
aagcggcatctcgtgaccctcttctccgcacccaattattgtggcgagttcgacaacgcg
ggtgcgatgatgagtgtggacgagaccttgctgtgctccttccagattctcaaaccggcg
gagaagaaggcgaagtacccatacggtggcatgaatatggggcgcccagtaacgccgccg
cgcaagcagaagaagaaggacagcaagatgggctaa

DBGET integrated database retrieval system