KEGG   Schizophyllum commune: SCHCODRAFT_13040Help
Entry
SCHCODRAFT_13040  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
scm  Schizophyllum commune
Pathway
scm00790  Folate biosynthesis
scm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCHCODRAFT_13040
Enzymes [BR:scm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SCHCODRAFT_13040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF HATPase_c_2 DUF3638
Motif
Other DBs
NCBI-GeneID: 9588595
NCBI-ProteinID: XP_003038250
JGI: Schco1_13040
UniProt: D8PKZ5
Position
Unknown
AA seq 180 aa AA seqDB search
MAAAVRTILECIGEDPDREGLLRTPIRYAQALMYLTKGYEERLVDVINDAVFAEDHDEMV
IVRDIDIASLCEHHLVPFTGKVSIAYIPNKLVLGLSKLARIAETFSRRLQVQERLTKQIA
IAVEEAIKPRGVAVVMQATHLCMTMRGVQKPGSLTVTSCMLGCFRTQQKTREEFLTLIKH
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgtgcgtaccatcctcgagtgcatcggcgaggacccagaccgcgagggc
ctcttgcgcacacccatccgctacgcgcaggcgctcatgtacctcacgaaggggtacgag
gagcggttggtcgacgtcatcaacgacgccgtgtttgcggaggatcacgatgagatggtc
atcgtgcgcgacatcgacatcgcgagtctgtgcgagcaccatctggtccccttcactggc
aaggtctccatcgcctacatccccaacaagctcgtcctcgggctctccaagctcgcgcgc
atcgccgagaccttcagccggcgcctccaagtccaggagcgcctcacaaagcaaatcgcc
attgccgtcgaggaggcgatcaagccacgcggagtagccgtggtcatgcaggcgacccac
ctttgcatgacgatgcgcggcgtgcaaaagccgggttcgcttaccgtcacctcctgcatg
ctcggctgctttcgcacgcagcagaagacgcgggaggagttcctgacgctcatcaagcac
tag

DBGET integrated database retrieval system