KEGG   Schizophyllum commune: SCHCODRAFT_13487Help
Entry
SCHCODRAFT_13487  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
scm  Schizophyllum commune
Pathway
scm00670  One carbon pool by folate
scm00790  Folate biosynthesis
scm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCHCODRAFT_13487
   00670 One carbon pool by folate
    SCHCODRAFT_13487
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SCHCODRAFT_13487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 9584934
NCBI-ProteinID: XP_003038636
JGI: Schco1_13487
UniProt: D8PQ90
Position
Unknown
AA seq 210 aa AA seqDB search
MSRLTLIVAATKANGIGQNGSLPWRLPKEMSYFAKVTSNAPEGKQNRVIMGRKTWESIPA
KFRPLRDRLNVVLSRRAEFKQCVHTIQVIYWRLTQTDRAGADVFPSLSAAIDTAASGQAH
RTYVIGGATLYKESLALTPSETEPFVDRIIITRVLDPAFDACDAFFPDFTADSAWRQATH
DELEGWLGFDVPRGVQEEKGVMYEFQMWVR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtttaactctcatagtcgccgccacgaaggcaaacggcatcggccagaatggc
agcctaccctggcgattgcccaaggagatgtcgtacttcgctaaagtaacctccaatgcg
ccagaaggcaagcagaatcgagtcatcatgggcaggaaaacctgggagagcattccggcg
aagttcagacccttgcgcgaccgactgaacgttgtactcagccgtcgggcagagttcaaa
cagtgcgtccacacaattcaagtgatttattggcgtctcacgcagaccgacagggctgga
gccgatgtcttcccaagcctgagtgcagccatcgatacagcggcctcaggacaagcccac
cgcacgtatgtcataggcggagcgaccctatacaaggaatccttggcactcacaccgtcg
gagaccgaacccttcgtcgatcgcattatcataacgcgcgttctggacccggcattcgat
gcgtgcgacgcgttctttcccgacttcacagcagacagtgcgtggaggcaggcgacccac
gatgagcttgaagggtggttgggattcgacgtgccgcgaggcgtacaggaggaaaagggt
gtcatgtatgaattccagatgtgggtgcggtag

DBGET integrated database retrieval system