KEGG   Schizophyllum commune: SCHCODRAFT_15746Help
Entry
SCHCODRAFT_15746  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
scm  Schizophyllum commune
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SCHCODRAFT_15746
  Replication and repair
   03420 Nucleotide excision repair
    SCHCODRAFT_15746
Transcription machinery [BR:scm03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SCHCODRAFT_15746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 476 aa AA seqDB search
MSSLSTQSVPHSLLPFLQSQPQNTLARLYQRPSSCLSIFRLLGPLERQIVMNLLWLESAV
PVSTMGAWVVREHQKIYEAALETLGKLHIVPTSPVKLAVHPTFKSSLRQALTGGGTQGSF
GIPAEPDGKQQAPDVGKLDGYALERWETILHFMVSSGTGQESAQPAAGVTYLLKESGLME
SRGGTLRITSAGFQFLLLTPHAQLWELLIHYLRLQEANNIDLVEVLSFLFMVSTTEFGQG
NLEMLTGDLHQEYSTENLSTSQLVVMDDLRHYGLLWQRKKNYPRFSPTRLATTLTSSAPP
LPTSSGPTSGPKEGFIVLETNYRVYAYTDNALQTAVLNLFITPKYRFPNLVVGSITRESV
KRAMSNGITADQIISYLITHAHPQMHKNVCLVANPLLPVTVQDQIRLWELERNRTKSQEG
FLYTEFASQADYEYVLNYAKQLGVVLWENHAKRCFFAAQEGHANIKSFIERKRAGM
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctctgtcgactcagagcgtcccgcattctctgctgccttttcttcagtctcaa
ccacaaaataccctcgcacgactataccaacgaccttcgtcatgtctttctatcttccga
ttgcttgggcccctcgagcgtcagattgttatgaatcttttgtggcttgagtccgctgtt
ccagtgtcgactatgggcgcttgggtcgtccgtgaacaccagaagatctacgaggccgca
ttagaaacgctgggaaaattgcatatcgtccctacgtccccggtaaaattggctgtacat
ccgacattcaagtcaagcttacgacaggccctaaccggagggggcacgcaagggagtttt
gggataccagccgaaccagatggcaagcagcaggcgcctgatgtaggaaaactcgacgga
tacgcgctcgagcggtgggagacgattctccacttcatggtgtcctccggcacagggcag
gagtccgcacaaccagctgccggcgtcacgtacttgttgaaggagagcggcctgatggag
agccgagggggaacgctgcgcattacttcggctgggttccagtttcttcttttgacgcct
cacgcccagctttgggagctcttgatacactatctgcgtttgcaagaggccaataatatc
gatctcgtcgaggtcctcagcttcctcttcatggtctcgacaacggaatttgggcaaggc
aacctcgaaatgcttaccggcgacctacaccaggagtactcgacggagaacctgagcacc
agtcagctagtcgtgatggacgacctgcgtcactacggtctgttgtggcagcggaagaag
aattatcctcggttcagccccacgagactagcgaccaccctcacctcctccgcgcccccg
ttacccacatcctccggcccaacgtcaggccccaaagagggcttcatcgtccttgaaacg
aattacagggtgtatgcatacacagacaacgcgctccagacggccgtcctgaatttgttc
atcacgccaaagtataggtttcccaacctcgtcgtcggatcgatcacgcgcgagagcgtc
aagcgggcgatgtccaatggcattacagccgaccagattatcagctacctgattactcac
gcgcacccccaaatgcacaaaaatgtatgtctcgtggctaaccctctgctacctgtcacc
gtccaggaccaaatccgactctgggagctcgagcgcaaccgcacgaaatcacaggagggg
ttcttgtacacggagttcgcgtcgcaggcggactacgagtacgtcctcaattatgcgaag
cagctgggggtcgtgctgtgggagaaccacgcgaagcgctgcttcttcgccgcgcaggaa
ggtcacgcgaacatcaagtcgttcattgaacgcaagcgggctggcatgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system