KEGG   Schizophyllum commune: SCHCODRAFT_16601Help
Entry
SCHCODRAFT_16601  CDS       T01331                                 

Gene name
pkac2
Definition
(RefSeq) cAMP-dependent protein kinase A catalytic subunit
Organism
scm  Schizophyllum commune
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 427 aa AA seqDB search
MSVIKRMTERFHIGSSKGYQYPDVDVGGSPYSTAPTPSLISANTTLFDHRGSLSTQRTSF
SELSGHRQGLGAIPEQEDMEARLNRLHLFSRNKGIYRLQDFLIQRTLGTGSFGRVLLVRS
KHNLRFYAIKVLNKEKVLRMKQVEHTNNERNMLHRVNHNFIINLWGAFQDGNNLYMVMDF
VPGGELFNLLRRSIRFPEPVAKFYAAEVSLALRYLHSNNIIYRDLKPENILLNADGHIKV
ADFGFAKIVDTVAYTLCGTPDYLAPEIIWGGRYNKSVDWYALGVLCYEMLSGLPPFHTPD
GNPQTLYAKIREGPNSLPWNSPNFTLYSIDLIRRLMEGEPSKRYGNMRHGAGDVFAHPWF
AEVDWEKLEDREVSPPYIPNIGGAGDASAFDIYHEDGMEELFRPPPLDTLADQFPDFDYT
YDDSVAP
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttatcaagcgcatgacggagcgcttccacatcggttcgagcaagggttaccag
taccccgatgtcgacgtcggcggtagcccgtactcgaccgcgccgacgccgtcgctcata
tccgcgaatacgacgctatttgatcaccgcggatccctcagcacccagcgcacgtcgttc
agcgagctgagcggccatcggcaggggctcggcgcgatcccggagcaggaggacatggaa
gcgcgcttgaatcggctgcacctgttctcgcgaaacaagggcatctatcgattgcaggac
tttctcatccagcggacgctgggcacgggcagcttcggacgcgtgctcctcgtgcggagc
aagcacaacctgcgcttctacgcgatcaaggtgctcaacaaggagaaggtgctccgcatg
aagcaggtcgagcacaccaacaacgagcggaacatgttgcaccgcgtcaaccacaacttc
atcatcaacctctggggcgcgttccaggacgggaacaacttgtacatggtcatggacttc
gtccccggtggcgagctcttcaacctgttgcggcgatcgattagattccctgaacccgtc
gcgaagttctacgctgctgaagtctcccttgcccttcgatacctccactcaaacaacatc
atataccgcgacttgaagcctgaaaacatcctcctcaacgcagacggccacatcaaggtc
gctgacttcggcttcgccaagatcgtcgacacagtggcctacactctctgcgggacacca
gattatctggcaccagagatcatctggggcggccgctacaacaaatccgtcgattggtac
gccctcggcgttctttgctacgagatgctctccggcctcccgcccttccacacccccgac
ggcaacccgcaaaccctgtacgccaagatccgcgagggccccaactcccttccctggaac
tcgcccaacttcacgctctactccatcgacctcatccggcggctcatggagggcgagccc
tcgaagcggtacggtaacatgcgccacggggccggcgacgtgttcgcgcacccgtggttc
gcggaggtcgactgggagaagctggaggaccgggaagtgagcccgccgtatattccgaat
atcgggggcgcgggggatgcgtcggcatttgacatttaccacgaggatgggatggaggag
ctcttcaggccgccaccactcgacacgctcgcggaccagttccccgactttgactacacg
tacgacgattcggtggctccttga

DBGET integrated database retrieval system