KEGG   Schizophyllum commune: SCHCODRAFT_17138Help
Entry
SCHCODRAFT_17138  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
scm  Schizophyllum commune
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 358 aa AA seqDB search
MDERTTQFVIQSNYQPLDVIGEGAYGVVCSALHMPTQRKVAIKRITPFDHSMFCLRTLRE
IKLLRHFHHENIIAILDILRPPSLQDFTEVYLVQELMETDLHRVIRTQELSDDHCQYFIY
QTLRALKALHSADVLHRDLKPSNLLLNANCDLKLCDFGLARSARPPPNVEDSSTFMTEYV
ATRWYRAPEVMLTFKEYTRAIDMWSVGCVLAEMLSGKPLFPGRDYHHQLSIILDILGTPS
LDDFYAITSQRSREYIRALPFRKKKSFRYLFPDANPLAVDLLEQLLTFSPKRRIDVEQAL
KHPYLAPYHDPQDEPTAEPLDPSFFSFDNGEQMRKEDLKVLIYEEVTRPQPFQLSEEA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacgcacgacccagttcgttatccagagcaactaccagccgctggacgtcatt
ggtgaaggcgcatatggcgtcgtgtgttccgcgctgcacatgcccactcagcgcaaggtc
gcaataaagcgcatcacccccttcgaccacagcatgttctgcctgcgcaccctgcgcgag
atcaagctcctccggcacttccaccacgagaacatcatcgcgatcctcgatatcctgcgt
ccccccagtttgcaagacttcacggaggtgtatcttgtgcaggagctaatggagacggac
ctgcaccgtgttatacggacacaggagctcagtgacgatcactgccaatatttcatctac
cagaccctccgcgctcttaaggcgcttcactctgcagatgtactgcaccgagacctcaaa
ccctccaacctcctcttgaacgcaaattgcgatctcaagctatgcgacttcggtctcgca
cggtccgcacgaccgcctccaaatgtagaggacagcagcacattcatgacggaatacgtt
gcaacaagatggtatcgcgcccccgaagtcatgctcaccttcaaagagtacactcgagcc
atagacatgtggtccgtcggctgcgtcctcgctgagatgctcagcggcaagcccctcttc
cccggcagagactatcaccaccagctgtcgatcattctcgacatccttggcacgccctcg
ctggacgacttctacgccatcacctcgcagcgctcgcgcgagtacatccgcgcgctccca
ttccgcaaaaagaagagcttccggtacctcttcccggacgcgaacccgctcgcggtcgac
ctccttgagcagctgctcaccttcagcccgaagcgccgcatcgacgtcgagcaggcgctc
aagcacccgtacctcgcgccataccacgacccgcaggacgagccgacggccgaacccctc
gacccgtccttcttctccttcgataacggggagcaaatgcggaaagaggacctgaaagta
ctgatttacgaggaagtcactcggccgcagcccttccagctctccgaagaggcatag

DBGET integrated database retrieval system