KEGG   Schizophyllum commune: SCHCODRAFT_231098Help
Entry
SCHCODRAFT_231098 CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
scm  Schizophyllum commune
Pathway
scm00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCHCODRAFT_231098
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SCHCODRAFT_231098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 NAD_binding_6 FAD_binding_6 DUF4101
Motif
Other DBs
NCBI-GeneID: 9589025
NCBI-ProteinID: XP_003038374
JGI: Schco1_231098
UniProt: D8PMC0
Position
Unknown
AA seq 329 aa AA seqDB search
MSATFLRATSAIRPLSQSARFGARRFASTAPETPKKASNAPLYFALAGLAGAGAYYTLYR
EDAAPVPKQEKSPLDPDNFIDFKLKKVIPYNHNTSTFVFELPDNQSSMLPVASCVVTKSD
TLLDDKGKPVIRPYTPITPSDKQGRAVDPDQEVRHWQDVEAHLEMKEGDKLGIKGPIMKI
PWQINQFDEVAMIAGGSGITPMHQILEYALKNKENKTRFTLIFANVTEKDILLKEQFDEW
EKKYPNTFKAVYTLDKPSEGWKGPTGYVNAELIKQHVAPATLGEKVKVLVCGPPGQVASL
AGKKAGYAQGELSGVLKELNYTPEQVFKF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgaccttcctcagggcgacctctgccattcggcccctttcccaatctgcgcgc
ttcggagcccgtcggttcgcgtcgaccgcacccgagactcccaagaaggcgtcgaatgcg
cccctctacttcgccctggccggtctggctggcgccggcgcctactacacgctctaccgc
gaggacgcggcgccggtccccaagcaggagaagagcccgctcgacccggacaacttcatc
gacttcaagctgaagaaggtcatcccttacaaccacaacacctccaccttcgtcttcgag
ctcccggacaaccagtcctcgatgctccccgtcgcgtcgtgcgtggtcacaaagtcggac
acgctcctggacgacaagggcaagcctgtcatccgcccgtacaccccgatcacgccctcg
gacaagcagggccgagctgtcgatcctgatcaagaagtacgacactggcaagatgtcgaa
gcacatcttgagatgaaggagggcgacaagctgggtatcaagggtcccatcatgaagatc
ccgtggcagatcaaccagttcgatgaggtcgccatgattgctggcggtagcggcatcacc
cccatgcatcagatcctcgagtacgcgctcaagaacaaggagaacaagacgcgcttcacg
ctcatcttcgccaacgtcaccgagaaggacatcctcctcaaggagcagttcgacgagtgg
gagaagaagtacccgaacaccttcaaggccgtctacaccctcgacaagccgagcgagggc
tggaagggtccgactggctacgtgaacgcggagctcatcaagcaacacgtcgcgcctgcg
actcttggcgagaaggtcaaggtgcttgtgtgcggcccgcctggtcaggtagcttcgctt
gctggcaagaaggccggctacgcgcagggcgagctttcgggcgtgttgaaggagctcaac
tacacccccgagcaggtgttcaagttctag

DBGET integrated database retrieval system