KEGG   Schizophyllum commune: SCHCODRAFT_231100Help
Entry
SCHCODRAFT_231100 CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
scm  Schizophyllum commune
Pathway
scm00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCHCODRAFT_231100
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SCHCODRAFT_231100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9 DUF4101
Motif
Other DBs
NCBI-GeneID: 9589027
NCBI-ProteinID: XP_003038376
JGI: Schco1_231100
UniProt: D8PMC4
Position
Unknown
AA seq 339 aa AA seqDB search
MSATFLRATSAIRPLSQSQSARFGARRFASTAPETPKKASNAPLYFALAGLAGAGAYYTL
YREDAAPVPKQEKSPLDPDNFIDFKLKKVIPYNHNTSTFVFELPDNQSSMLPVASCVVTK
SDTLLDDKGKPVIRPYTPITPSDKQGELSILIKKYDTGKMSKHIFEMKEGDKLGIKGPIM
KIPWQINQFDEVAMIAGGSGITPMHQILEYALKNKENKTRFTLIFANVTEKDILLKEQFD
EWEKKYPNTFKAVYTLDKPSEGWKGPTGYVNAELIKQHVAPATLGEKVKVLVCGPPGQVA
SLAGKKAGYAQGELSGVLKELNYTPEQVRVAATRASVSR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgaccttcctcagggcgacctctgccattcggcccctttcgcagtcccaatct
gcgcgcttcggagcccgtcggttcgcgtcgaccgcacccgagactcccaagaaggcgtcg
aatgcgcccctctacttcgccctggccggtctggctggcgccggcgcctactacacgctc
taccgcgaggacgcggcgccggtccccaagcaggagaagagcccgctcgacccggacaac
ttcatcgacttcaagctgaagaaggtcatcccttacaaccacaacacctccaccttcgtc
ttcgagctcccggacaaccagtcctcgatgctccccgtcgcgtcgtgcgtggtcacaaag
tcggacacgctcctggacgacaagggcaagcctgtcatccgcccgtacaccccgatcacg
ccctcggacaagcagggcgagctgtcgatcctgatcaagaagtacgacactggcaagatg
tcgaagcacatctttgagatgaaggagggcgacaagctgggtatcaagggtcccatcatg
aagatcccgtggcagatcaatcagttcgatgaggttgctatgattgctggcggaagcggc
atcacccccatgcaccagatcctcgagtacgcgctcaagaacaaggagaacaagacgcgc
ttcacgctcatcttcgccaacgtcaccgagaaggacatcctcctcaaggagcagttcgac
gagtgggagaagaagtacccgaacaccttcaaggccgtctacaccctcgacaagccaagc
gagggctggaagggtccgaccggctacgtgaacgcggagctcatcaagcaacacgtcgcg
cctgcgactcttggcgagaaggtcaaggtgctcgtgtgcggcccgcctggtcaggtcgcc
tcgctcgctggcaagaaggccggctacgcgcagggcgagctttcgggcgtgttgaaggag
ctcaactacacccccgagcaggtgagagtggctgctactcgggcgtcggtctcgcgctaa

DBGET integrated database retrieval system