KEGG   Schizophyllum commune: SCHCODRAFT_232399Help
Entry
SCHCODRAFT_232399 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
scm  Schizophyllum commune
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SCHCODRAFT_232399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1081 aa AA seqDB search
MSVDPPQRMYQPRAVTRDVSMQYTPTLPQHDHSMDIIDEPMRRSPSFRGSLPPTSSFRMR
MSATPQVEPIRESSMPPSLTDLNTNPAFVRAPSQGVESRQRLTPSNTLGTVAEQRHLFSP
TKSRSSLSYVFSAQETAPRAASGEAAQKALLELDAYKTPIIPSRRRKDTSDASALASTSR
PTTGPDLFKKKRKFVPMNEEEQLALNLTGQGKKKKKSKDKEARANDTKPYSKPDGLKKLM
TRHKAGEDPDASFESEGANELTRSDSQMDTSTGTTEKENKTNEPTVPDLPPQDNFAPRSA
DAPAQGSSLRIGRTKTSRQHLARPTIQRPLKKKFSAAFEDDDVDDDMEERNQEIEKLNEI
QAKAPPFKIDSNFFAKPPQAAPTSSDASKAKEPPVTSLPFSLGSPAPPAPKAPEPVKEAV
PAPAPEKPAPTPFSFSAPPKTDTPSASNGATSTSSSGGIPNFFSSSPALAKPLTLPTPTT
PLFGSPAATPKLDGAVPLPGTPKPAAPPAFSFGTPAPAEPVKDPNSPFWVGSKTAAAPAN
GSAASNGLPSGSLFGAPKVDEPPKSAPATTFSFEKKEEAPKSAAPTAAPFSFGKPAEPTK
PAESTSGLFGQPSTSSSTAGGLFGSTPAAPPATTVGFSFGAPAPATTPKPEEAPKPAPFS
FGAPAPAAEAPKPSTPFSFGQPAASSDSAPKPLFGAPASITEAPKPAFGAAPSVQAPKPL
FGAAPSADAPKPLFGSAPSSPAPFSFGQPAKTDAPAASPFSFGAAPSTPKPEEKKPAFSF
GAPAATPAAPAPFSFGSSTAAPATTEAPKPFSFGAPAPARPSTPPKNDDDGMRMEESPTR
EITKAEPSKLTLNTGGASFSFGGSTGGFGSASSTTAPSNPFAFGAPAASKPEENKPAFGG
FGQPAQTGFSFGQSKPAEAAEPQRPATTGSFGFGASTPTSSASPFAFGTPSSSNNANPFG
GASSQSGSAPNSPSTFHQPSPFSFGAPAPIQQTNSFSFGSQPASPAVPSATLPQPGTPSG
AFGASNAFSVASPTSPFTSAPNSAGTDGGGLFTMGSASSNAPPAPGPGGRPVRRLPTRRK
H
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgatcccccgcagcgcatgtatcagcctcgcgcagtcacaagagacgtgtcg
atgcagtatacgccgacccttccccaacatgatcactccatggacatcatcgacgagccc
atgaggcgttcgccatcgttccgcggatcgctgccgccgacctcctcgttccgtatgcgc
atgtctgccacgccccaagtcgagcccatccgcgaatcgtccatgccgccgagcctcaca
gacctcaatacgaatccagccttcgtacgtgcaccgtcgcaaggcgttgaaagccgtcag
cgcttgacacctagtaacacgctgggcacggtggccgagcaaagacacctcttctctcct
acgaagtcgcgcagctcattgtcgtatgtcttttctgctcaggaaaccgcgccgcgcgcc
gcttccggagaggccgctcaaaaagcgcttctcgagcttgacgcgtacaaaacacccatc
attccaagccgccgtcgcaaggacacatccgatgcctctgccctcgcaagcacgtctcgc
ccaacgactgggcctgacctcttcaagaagaagcgcaaattcgtgcccatgaacgaagaa
gagcaactcgctttgaacctgacaggtcagggcaagaagaaaaagaagagcaaggataag
gaggccagggcgaatgacacgaagccatactcaaagccggatggtctgaagaaattgatg
acccgtcacaaagccggagaggatcccgacgcgtctttcgagtccgagggcgccaatgag
ctcacgcgtagcgatagtcagatggacacgagcaccggcacgactgagaaggagaacaag
acgaatgagcccactgtgccggacctgccgcctcaggacaactttgcgccccggtctgcc
gacgcacccgctcagggctcgtcattgcgcattggacgcacgaagaccagcagacagcat
ctcgcacgcccaaccatccaacggcctctcaagaagaagttctcggcagcctttgaagat
gatgatgttgatgacgacatggaagagcgcaatcaagaaatagagaagctaaacgagatt
caggcgaaggcccctccgttcaagattgacagcaacttctttgcgaaaccgcctcaagcc
gcacctacttcgtcagatgcatccaaggccaaggagccgcccgttacgtcccttccgttc
tcgctgggctcaccggcaccgcccgccccgaaggccccagagccggtgaaggaggctgtt
ccagccccagctccggaaaagcctgcccccacccccttctcttttagtgcgccgccaaag
accgacacgccctcagcctcgaatggggcaacgtctacctcttcgtcgggcggcatcccg
aacttcttctcatcatcgcccgcccttgcgaaacccctcacactccctactcccaccacg
cctctctttggctcgcccgctgccactcccaagcttgatggcgctgtgcctctgcctggt
acgcccaagcctgcggcgccgccagcgttctcattcggcacgcccgcgcctgctgagcct
gttaaggacccgaatagcccattctgggtgggctccaagacggctgcagcaccagcgaac
gggtcggcggcctccaacggtctgccctcgggctcgctgttcggcgcgcccaaggtcgat
gaaccaccaaagtccgctcctgctacgacgttctcgttcgagaagaaggaagaggcgccg
aagtcggccgcacctaccgctgccccattctcgttcggcaagcctgctgagcccaccaag
ccggcggagagcacgagtggtttgtttgggcagccttcaacgtcgagctcgacagcgggc
ggtctgttcggtagtacgcctgctgcgccgcctgcaacgactgtaggcttctcgtttggt
gcgcctgcgcctgcgacgacgccgaagcccgaggaggcacctaagcccgcgccattctca
tttggtgcgcccgcccctgcggccgaggctcccaagccgtccactcccttctccttcggc
cagcctgcagcatcgtcggatagcgcgcctaagcctctgtttggtgcccccgcatcgata
acggaggcgccgaagccagcgttcggagctgcgccatccgttcaggctccgaagccactc
tttggcgctgcaccgtctgccgacgcgcccaagccgctcttcggttccgccccatcgagc
cctgcgccgttctcgttcggtcagcccgcgaagacggatgcgccagcggcgtcgccattc
tcgttcggtgctgcgcccagcacgccgaagcccgaagagaagaagccagcgttcagcttc
ggtgctccggcagcgacgccagctgcgcctgcgccgttcagcttcggatcctctaccgct
gcgcctgccacgaccgaggcgcccaagcccttctcgtttggtgcacctgctcctgcccgt
ccgtcgacgccgccgaagaacgatgacgatggcatgcgaatggaggagagcccgacgagg
gagatcaccaaggccgagccgtcgaagctcacgctgaacacgggcggcgccagcttctcg
tttggcgggagcaccggtggcttcgggtctgcgagctcgaccaccgcaccgtcgaaccca
ttcgccttcggtgcgcctgccgcaagcaagccagaggagaacaagcctgcgttcggtggc
ttcggtcagcctgcacagactgggttctcctttgggcagagcaagcctgcggaggccgcg
gagccgcagcggcctgcgacaactggatctttcggctttggcgcgagtacacctacttcg
tcggcgtcgcccttcgccttcggcacgccatcgtcgtcgaacaatgccaatcccttcggt
ggggcgtcctcgcagtcaggctcagccccgaacagcccgtcgacctttcatcagccttcg
ccgttcagctttggtgcacctgcgcctatccagcagaccaactcgttctcgtttggcagt
cagcctgcatcgcccgctgtgccttccgccacgttgccgcagccgggcacgcccagcggt
gccttcggagcctcgaatgccttcagcgtcgcgtcgccgacatcgcctttcacttccgca
cctaactctgctgggaccgatggtggcggtctgttcaccatgggctcggccagcagcaac
gccccgcccgcgcctggccctggtggaagacctgtccgtcgtctgcccacgcggcgcaag
cattga

DBGET integrated database retrieval system