KEGG   Schizophyllum commune: SCHCODRAFT_235382Help
Entry
SCHCODRAFT_235382 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
scm  Schizophyllum commune
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SCHCODRAFT_235382
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCHCODRAFT_235382
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SCHCODRAFT_235382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 460 aa AA seqDB search
MTSTIPQPAGWPFIGNIFEIDTSFSCQTFHRLMQQFGEIYQLNLMGRRLIVVSSHALLNE
LSDDRRFKKAVGGALMEARNLLHDGLFTAFNHEANWAVAHRLLSPSFRPSAVRQTFDGMR
EICADLVGKWVRNDDQAPIDLTADFTRLALDTIAYCTMSYRMNSFATDDPPRFNEAMSAF
LLECNGRANRPYLINFFMRGRNAAYTSNIEYMRGVAENIIAERRISGREKHDLLHALLHG
RDPRTKEGLSDREVADNVLTFLLAGHETTSATMSFAIYYILKNPDVLRKLQTEIYTVVGD
QPIQCEDLDHLHYLTAILRETLRLQPPAFIRVVYSVEDTTIGGGSRLSSRGYGLSNHGTE
FEVTELTDTQAHEFRPERMADGRFEDLPPNAWQPFGYGARGCIGKNFSWQEMRLVLCTLV
QQFDLALADPAYELELSQAMTIKPKNLAIRATPKLLKACC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgacgatcccgcagccggcagggtggccgttcataggcaacatcttcgaaatc
gacaccagcttctcctgccagacttttcaccgcctcatgcaacaattcggcgagatctat
caactcaatctaatgggaaggcgactcattgtggtcagctcacacgcgctcttgaacgag
ctctcggacgatagaagattcaagaaggccgtcggcggcgccctgatggaagcacgaaat
ctccttcatgacggtctattcactgctttcaaccacgaagccaactgggcagtcgcgcac
cgcctgctttcgccgtctttccgcccgtccgccgtgcgccagacttttgacggcatgcgc
gagatatgcgccgaccttgtcgggaagtgggtcagaaacgacgaccaggcgccgatcgac
ctgacagcagactttacacgtctggctctggatacgatcgcgtactgcacgatgtcctat
aggatgaactcatttgcgacggacgaccctccccgttttaacgaagccatgtccgccttc
ttgctagaatgcaacggtcgggccaataggccctacctgatcaacttcttcatgcgcggg
cgcaacgcagcgtatacgtcgaatatcgagtacatgcggggggtggcggagaatatcatc
gccgagcgccggatctcagggcgcgagaagcacgaccttttacatgccctccttcatggg
cgcgatcctaggacgaaggaggggttatcggaccgggaggtggcggataatgtcctgacc
tttcttctcgctggccacgagacgacgtcggcgacaatgtcctttgcgatctactacatc
ctcaaaaacccagacgtcctgcgaaagctacaaacggagatatatacggtggttggcgac
cagccaatacagtgcgaggatttggatcacttgcattatttgacggccatcctgcgcgag
acgctgcgattgcagccgcccgcgttcatccgcgtagtctactctgtcgaggacacgacg
ataggcggcggcagtcgtctatcgagccgcggatatggcctttcgaaccacggaacagag
tttgaggtcacggagctgacagacacgcaggcgcacgaattccgcccagagcggatggca
gacggtcgattcgaagatttacctcctaatgcgtggcagccgtttggctacggcgcccgc
gggtgcatcgggaagaacttttcgtggcaggagatgcggctcgtcctctgcacgctggtc
caacagttcgacctcgcactcgccgaccctgcgtacgagctggagctatcgcaggcgatg
acgatcaagccaaagaatctggcaattcgggcgacgccgaagctgttgaaagcgtgttgt
tag

DBGET integrated database retrieval system