KEGG   Schizophyllum commune: SCHCODRAFT_235958Help
Entry
SCHCODRAFT_235958 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
scm  Schizophyllum commune
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SCHCODRAFT_235958
Enzymes [BR:scm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     SCHCODRAFT_235958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1114 aa AA seqDB search
MAPKQQQRHTSASTSRTTGARATGVLEWRFTNKMMNVRDLSRDDDFLSHLLVEKLGTGDV
PLLVHKMDSSRALPKTDAAVLMNIVRRLVVAKGPLQHVVREAVNELLRLPAVLYYLKSYT
QQQINAFATHAARYFELYHPSGCIEIAHTSRYSLYTGKSELCILATRDLAPGAVISELKG
SMANLTEDEDRALKETQINSAIRRDFSVIHSRQMKKNHLFLGPARFVNHDCDHNCELFRE
GKYITFRVIKPIKLGQEVTAHYGDSYFGKGNKHCLCETCEKNGRGGYDPANQGDDAGSSS
DGSDVSDVESVEEAPVNVNERRTRRGVYATTVPEVEAISSDSEEEEDNTNRPLANAAPGA
IEVVAVGDSDLTPIPSDSEPAGSTQQPVAGPSNSRAPPAVPPPTGAVEGSPVGSPLTVVD
EMSSPKLPSPKQSTISPQQPFRSIIATRRQKMLGIGAEASASVTVPPTTQLASPALTEDA
TSSISTAGFNRTPTTTRTTRTSARKQAEANGKESVSKGKGPEAKAKAAGKGKEPEAKGKE
AAGKVKEVDGTNKPPAKSSKPGTVAQSEPPQQEPAKDDTPKQPVRFSTRLKGKGKGKEVS
ASPVTIASAKNVSIRRRKRSEERDAEVVPAKRGRPSLADLAAREPPPKVPGGPKGPGRQA
TASVCNMQERAAGDLCGLPARLGPGSRFCDAAGKTGMSSPVEFLPTPRSTTPEPAHAKRV
TARALPMLDKKLQAAAAARSAQREETDDEDGRPAKKRRVDDSASAGPNAVPVPKRRGRPP
KNPPAATAPPPATALPPVELKQEENADSTVPLKRKRGRPPKNPALRAAQLAAAASAPVGQ
PMKSEPQPRTLGGQFDRKHRELPKTTPKSRAQRAEDRERVRKDMERRGVVPTAVGDSSDE
EVTEIDGVRWKGKQRQDAQAAFSESVSAGRMRGQPGSGLRDAPRKRKLVDASDLGSAPHP
PPPPPGRRRVEEAGGARMVVAATGNAGFSGGRLWRASPAGYARNFVDVGEFEVEEILPPA
SASARVLQTIEDSPEPQARPSKVYVDAAVGSDNEMTDQSDSEESEILTGYRYDYPRVPIP
STPVPLKCFYPTHARDDPHYESAVWESSPLSDKE
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaagcaacagcagcgccatacgagcgcgagtacatcgcgcaccactggtgcc
cgcgcgacgggtgtccttgaatggcgcttcaccaacaagatgatgaacgtccgcgaccta
tcgcgcgacgatgactttctcagtcatcttctcgttgagaagctcggcaccggcgacgtt
cccctcctcgtgcacaagatggattcgtcgcgcgccctcccaaagacggacgccgcagtg
ctcatgaacattgttcgacgccttgtggttgctaagggtcccctgcaacatgtcgtgcgc
gaagcagtaaatgaactcctccgactccccgccgtcctttactacctcaagagctacacg
cagcagcagatcaatgccttcgctacccacgccgctcgctactttgaactttaccatcct
tccggctgcatagagatcgcgcacacctcccgctactctctctacactggcaagtctgag
ctctgcatactggccactcgtgaccttgcccctggcgccgtaatctccgagctcaagggc
tccatggccaacctgaccgaggacgaggacagagccctcaaggagacgcaaatcaactca
gctatccgccgcgatttcagcgtcattcattcccgccagatgaagaagaaccacttgttc
ctcggccccgcgcgcttcgtaaaccacgattgcgaccacaactgcgagctttttcgtgaa
ggcaaatatatcaccttccgtgtcatcaagcctatcaagctcggccaggaagtcaccgcc
cattatggcgactcgtacttcggcaaggggaacaagcactgcctttgcgagacctgcgag
aagaacggacgcggtggttacgatccagcgaatcaaggcgacgatgcgggctcgtcctcg
gacggtagcgacgtcagcgacgtggaaagcgtggaggaggcccctgtcaacgtcaatgag
cgtcgcacgcggcgtggcgtgtacgcgactacggtacccgaggtggaagcaatttcctcc
gacagtgaggaagaggaggacaacacgaacaggccactggccaatgcagcgcccggcgcg
atcgaggtcgttgctgtgggcgattctgaccttacgcctataccctcggactccgaacct
gcagggtccacccagcaaccggtggcagggccttcaaatagcagagcaccgccagccgtg
ccacctcctaccggcgcagtggaaggttcccccgtcggtagccctctgaccgttgtcgac
gagatgtcgtcgcccaagctgccctctcccaagcagtcgaccatcagccctcaacagccg
ttccggtcgatcatcgccacccggaggcagaagatgttgggaataggcgccgaagccagt
gcatcagtcaccgtgccacccactacacagttggcgtccccggcgctcacggaggacgcg
acatcatccatctctacagccggctttaatcgtacgccgacaacgactcgtacgacgcgc
acgagcgcccgtaagcaagctgaggcgaacggcaaagagtcagttagcaaaggcaagggg
cctgaagcgaaggcgaaggcagccggcaaaggcaaggagcccgaggccaagggcaaggag
gctgcagggaaggtgaaggaagtggacggcaccaacaaaccgcctgcgaagtcctccaag
cctggcacagtcgctcaatcggagccgccgcaacaggagccggctaaagacgacaccccg
aagcagccagtacgattctccacccggctgaagggcaaggggaagggcaaggaagtcagt
gcatcacccgtgacgatagcgtcggcgaagaatgtctccattcgccgacgaaagcgaagt
gaagaaagagatgccgaggtcgtgcccgccaagcgtggacgaccgtctttggcggatctg
gctgcgagggagccaccgccgaaggtaccgggaggtcccaaggggcccggacggcaagcc
actgcctctgtgtgcaacatgcaagagcgtgctgccggtgatctgtgtggattaccagcc
cgtctggggccaggatctcgattctgcgacgcggcagggaaaacaggaatgtcctcgccc
gtcgagtttttgcctacgccccgctcaacgacgcctgagcccgcacacgcgaagcgggtc
acggcgcgcgcgctgcccatgctggacaagaaattgcaggcagcggcagctgcacgcagt
gctcagcgagaagagacggatgacgaagatgggcgacccgccaaaaagcggcgtgtcgat
gattcagcgtctgctggtccgaacgctgttcccgtaccgaagaggcgtgggcgtccgcca
aagaatccgcctgctgcaaccgctcctccgccagccaccgcgcttccgcccgtcgagctc
aagcaggaggagaacgcggattccactgtgcctctcaagcgcaagcgcggccgtccaccg
aaaaatcctgctttgcgagcagctcagttggcagccgctgcttcggctccagtcgggcaa
cccatgaaatcggaaccccagccgcgtacattgggcggtcagtttgatcgcaagcatcgc
gagctacccaagacaacccccaaatcgcgcgcgcaacgcgctgaagaccgcgaacgcgtc
cgcaaggacatggagcggcggggtgtcgtcccgacggcagtgggggatagcagcgatgag
gaagtgacggagattgacggagttcggtggaaggggaagcagcgtcaggacgcgcaggca
gcgttcagcgaatccgtgtctgcggggcgcatgcgtggccagcctgggagcggcttgcgc
gacgcgccgcgcaagcggaagttggtcgatgcaagcgacttggggtctgcgccgcaccca
ccgcccccgcctcctggccgaaggcgggtagaagaagcaggcggggctcggatggtcgtg
gccgcgacaggaaatgcaggattttccggcggacggctctggcgtgccagtccagcggga
tacgcgcgtaacttcgtcgacgtgggcgagtttgaagtggaagaaattttgccacctgcg
agcgcttctgcgcgggtcctgcagacgattgaggactctcctgagcctcaagcgcgccct
tccaaggtttacgtggatgcggcggtcggctcggacaacgagatgaccgatcaatctgat
tctgaggagagcgaaatcttgactggctaccgctacgactaccctcgagtgcctataccc
tctacgccggtccctctcaagtgtttctatccaacacacgcgcgagatgacccgcactat
gagtctgcggtgtgggagtcgtcgccgctctcggacaaggagtag

DBGET integrated database retrieval system