KEGG   Schizophyllum commune: SCHCODRAFT_254944Help
Entry
SCHCODRAFT_254944 CDS       T01331                                 

Definition
glycoside hydrolase family 10 protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SCHCODRAFT_254944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 362 aa AA seqDB search
MYALTMPLVALIPFLELIGQVNGLPNGLSTSELASSSSTRSAAATGMHTAADAQGRYFGT
FCDPASTYWNDAGFMALVDNAADVGQLTVSNSLKWDSTEPSQNSFTYTNPDRLVAYAQEH
GYIVRGHTLVWHSQLPSWVNNVAQSSVQDVMENHIANVAGHYVGKLYAWDVVNEPFNEDG
TWRSDAFYNALGDSYVALALNATRAVDPDVKLYINDYNVETPGAKSSALVALAKSLVSAS
APLQGIGFQGHFILGQTPSTSTLISQFEQYTSLGLEVAITELDIRIQQPASAQSLAQQQT
EFQNVVAACKAVDLCVGVTAAGMSDKYTWVPNTFPGYGSPLMFDESFKQKPAYTGVVDGW
GA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgctcacgatgcccctcgttgctctcatacccttcctcgaactcatcggtcaa
gtaaacgggctgcctaatgggctctcgacatccgaactagcttccagtagctctactagg
agcgccgccgcgacgggaatgcacaccgctgccgacgcgcagggccgttacttcgggacc
ttctgtgaccccgcgtctacgtactggaacgacgctggcttcatggccctggtcgataac
gccgccgacgtcgggcagctcacggtctcgaactccctgaagtgggactcgacggagcca
tcccagaacagcttcacgtatacgaatccagaccggctcgtcgcgtacgctcaggagcac
ggctacatcgtgcgcggtcacacgctcgtgtggcactcccagctaccgtcgtgggtgaac
aatgtggcgcaatcgtcggtgcaagacgtgatggagaaccacattgcgaacgttgcaggg
cactacgtgggcaagctgtatgcttgggacgtagtcaatgagcctttcaacgaggacggg
acctggcgctcggacgcattctataatgccctcggtgattcctacgtcgctctcgccctg
aacgctacccgtgctgtcgatccggacgtgaagctctacatcaacgactacaacgtagag
acccccggcgcaaagtcgtccgccctcgtcgccttagccaagtccctcgtctccgccagt
gcgccactgcagggcattggcttccagggccacttcatcctggggcagacaccaagcacg
tcgactctcatctcgcagttcgagcaatacacgagtcttgggctcgaggtggccatcacg
gaactcgatattcgtatccagcagccagcgtccgcgcagagcctcgcacagcagcaaaca
gagttccaaaatgtggtcgccgcctgcaaggcggtcgacctgtgcgtaggcgtgacggcc
gcgggcatgagtgataagtatacgtgggttccgaacaccttcccaggatatgggtcgcct
ttgatgttcgacgaatcgttcaagcagaagccggcgtataccggtgttgtcgacgggtgg
ggcgcttag

DBGET integrated database retrieval system