KEGG   Schizophyllum commune: SCHCODRAFT_255392Help
Entry
SCHCODRAFT_255392 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
scm  Schizophyllum commune
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCHCODRAFT_255392
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     SCHCODRAFT_255392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 609 aa AA seqDB search
MAAPVVGPDASAVPLPPVRPVRPLHQSSLSTTSSSSTGSSILPEVVKEEELAHSSVALKA
KHYKHASFAANVLDIIHTINVPTWDHASIAPEDIKVFKVSGSMTNAVFFISCPSIPSAHT
LLLRVYGPSSGELISRPRELHTLHILSSRYHIGPRVYGTFANGRVEEYFESTTLSAEDLR
NPEISRWIGARMAELHSVDIDIVEDGAEWEIAATANVKSWLGHARDVLSLPAILEAARRE
IDIDAFEVEFRKYTEWLATVDDEQAGNRRVFAHNDTQYGNLLRLKALSPGVPKHRQIIVV
DFEYAAPNPAAFDIANHFHEWTANYHSDTPHLLDPTRYPTADERRNMYKAYADHSGIVGV
SDHWLGVLEDQSRLAYNAFSSSDDSRRMRISLFFGAVAFYYLLTSSAIDIPAYIPSSLSW
YTGATMSTVATPKGWYKRIAPHPAPEHWTPRREALALAVLRSTKVEPEGFTLALFSDKVE
DKHVAVDSLGRVVLVPKGDHDALVAHATDATALPETGMFRNLWQVARPTTGQPIDRIIVP
KEGGGNAEISVSGWAGSAEEAMPLKRPVEGHEELPVVLKELVGLALEAREEFDSGKVDQA
MVSRVKNIL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggccgcacctgtagtcggaccggacgcctccgcagtgcccctaccacccgttcgcccc
gttaggcccctccatcagtcgtcgcttagcacgacttcctcgtcctccaccggatcttcc
atcctacccgaagttgtcaaggaagaagagttggcacactcctccgtcgcgttgaaagca
aagcactacaagcacgcatccttcgcggcaaacgtccttgacatcatccacacgatcaat
gtgccgacatgggatcacgcgtcgatcgcgcctgaggacatcaaggtcttcaaggtctcc
ggttcgatgacgaatgccgtattcttcatctcatgcccatcgataccctccgcacacacc
ctgctactccgcgtctatggcccgtcctcgggcgagcttatctcccgcccgcgcgaactc
cacacccttcacatcctctcctcccgctaccacattggtccccgtgtatacggcaccttt
gcaaatggacgcgtcgaggagtacttcgagtccaccacgctctcggcggaggacttgcgc
aaccccgagatcagccgatggattggtgcacgcatggccgaactgcactcggtcgacatc
gacatcgtggaggacggcgcagagtgggagatagcagctacggcgaacgtcaagtcgtgg
ctcgggcatgcgcgggatgtgctctcgcttcctgcgatactggaagccgcacggcgagag
atcgacattgacgcattcgaggtcgagttccggaagtacaccgagtggttagctacggtg
gacgacgagcaggcgggcaaccgacgtgtattcgcgcacaacgatacacagtacggcaac
cttctccggctgaaggctctcagccctggtgtgcccaagcatcgacagatcatcgtcgtc
gacttcgagtacgcagcaccaaaccctgctgccttcgacatcgccaaccacttccacgag
tggacagccaactaccacagcgacactccccacctcctcgaccccacccgctaccccacc
gccgacgagcgccgaaacatgtacaaagcgtacgcggaccactcaggcatcgtcggcgtc
tccgaccactggctcggcgtgctcgaggatcagtctaggctcgcgtacaatgcattcagc
tcttcagacgactctcgacgtatgcgaatctccctcttctttggcgccgtcgcgttctac
tacctcctcacgtcctccgcgatcgatatccccgcctacatcccctcgtcgctatcctgg
tacacgggcgctactatgagcacagttgctacacctaagggctggtacaagcgcatcgcg
ccgcaccccgcgcccgagcactggacgccgcgcagggaggcgctcgcgctcgcggtcctc
cggagcacgaaggtcgagcccgagggcttcacgctcgcgctgttctcggacaaggtggaa
gacaagcacgtcgcagtcgactcactcggccgcgtcgtcctggtgcccaagggtgaccac
gacgccttggttgcgcacgcgacggacgcgacggcgcttcccgagacgggcatgttccgc
aacctatggcaagtcgcgcgcccgacgacagggcagccgatcgaccgcatcatcgtcccc
aaggaaggtgggggcaacgccgaaatcagtgttagtggctgggcgggcagcgcagaggag
gcgatgccgctgaagcgcccggtcgagggtcatgaagagcttcctgttgtgttgaaggaa
ttggtcgggcttgcattggaggcaagggaggagtttgacagcgggaaggtagatcaggca
atggttagcagggtgaagaatattctgtag

DBGET integrated database retrieval system