KEGG   Schizophyllum commune: SCHCODRAFT_255601Help
Entry
SCHCODRAFT_255601 CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
scm  Schizophyllum commune
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 146 aa AA seqDB search
MAPKPASTAGKAPASTASKAPAKAEKAAKKTASKSAPSGGADGEKKKRKKTRKETYSSYI
YKVLKQVHPDTGISNKAMAILNSFVNDIFERIATEASKLAAYSKKSTISSREIQTSVRLI
LPGELAKHAISEGTKSVTKFSSQGAK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaagcccgcatcgactgccggaaaggcacctgcgtccaccgcatccaaggcg
ccagccaaggctgagaaggcggcgaagaagactgcgtccaagtctgcaccgtccggggga
gctgacggggagaagaagaagcgcaagaagacgcgcaaggagacgtactcttcctacatc
tacaaggtccttaagcaggtccaccccgacacgggtatctcgaacaaggcgatggccatc
ctgaactcgtttgtcaacgatatctttgagcggatcgccacggaggcatccaagctcgcc
gcgtactcgaagaagtcgacgatttcatcacgcgaaatccagacgtctgtgcggctcatt
ctccccggtgagctcgccaagcacgccatctctgagggcaccaagtcggtgaccaagttc
tcttcgcagggtgccaagtag

DBGET integrated database retrieval system