KEGG   Schizophyllum commune: SCHCODRAFT_255886Help
Entry
SCHCODRAFT_255886 CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
scm  Schizophyllum commune
Pathway
scm00280  Valine, leucine and isoleucine degradation
scm00410  beta-Alanine metabolism
scm00640  Propanoate metabolism
scm01100  Metabolic pathways
scm01200  Carbon metabolism
Module
scm_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCHCODRAFT_255886
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCHCODRAFT_255886
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCHCODRAFT_255886
Enzymes [BR:scm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     SCHCODRAFT_255886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 9587360
NCBI-ProteinID: XP_003034863
JGI: Schco1_255886
UniProt: D8PV40
Position
Unknown
AA seq 458 aa AA seqDB search
MSTDASAAPAAEVLICPQPLVKLESVLSMRNYVLNRPAKLNSLNTEMLEQLRPKIEEWNR
SDIASTIVGTGTGQIALDSQDEGKRPTAIRFFKREFELDYILASLNKPYVVVMDGITMGG
GVGLSAPAPFRVATENTVFAMPETNIGYVPDVGASYYMSRLDGQLGTYLCLTGTTLRGRD
VFEAGFATHYIPSRRVPSLLERLASVEESNLTLVDRTIEELSCERQPEEGPFHLTGEVRV
ALDTAFRHDTVEQIVEELEVMAEKDSSEAVRQWASQTLSTLKVRSPTSLKLALYAIRQGK
NLNLIDALRMEHQLATAFCNQASPDFVAGITNVLLTKSKEPTKWQPDNLQGVTNDIIARF
VDKKSPFVDTKGQSFDIPADLAKKPLPFPYLYALPVEDEIAAMVKGSHKESGGNALKRKE
VIANFDRLREHKMGVKEKVEEVLSRRCTEDKDGFLVWN
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagacgcatcagccgcaccggctgcagaggtcctcatatgtcctcagccgctg
gttaagcttgagtctgtgctctccatgcgcaactatgtgctgaaccggccagcaaagctc
aactcgctgaacacggagatgcttgagcagctgcgaccgaagatcgaggagtggaacaga
tcggacattgcctcgacaattgtgggaactggcactggccaaattgcgctggattctcaa
gatgagggcaagcgccccacagccatccgcttcttcaagcgcgagttcgagctcgactac
attcttgcctccctcaacaagccctacgtcgtggttatggatggcatcacgatgggagga
ggtgtcggcctttccgcacctgcgccattcagagtggcgaccgagaacacggtgttcgcg
atgccggagaccaacatcggctacgtgccagacgttggcgcaagctactacatgtccagg
ctggacggccagctcggcacttatctctgtctcacgggcacaactttgcgaggacgcgac
gtctttgaggcaggctttgcaacacactacatcccatcccgaagggtaccgtcccttctg
gagcgcctcgccagcgtcgaggagtctaatttgaccctcgttgaccgcacaatcgaggag
ttgtcttgcgagcggcagcctgaggagggccctttccacttgactggggaagttcgcgtc
gcactcgacactgccttcaggcatgacaccgtcgagcagatcgtggaggagcttgaggtc
atggcggagaaggacagcagtgaggctgtcaggcaatgggcatctcagacgctgtccacg
ttgaaggtccggagcccgacaagcctgaagttggcactctatgccatacgccagggcaaa
aacttgaacttgatcgacgctctgaggatggagcatcagctagcgactgccttctgcaat
caagcttcgcctgacttcgtcgccggtatcaccaacgtgctccttacgaagtcaaaggag
cccacaaaatggcagccggacaacctccagggggtcaccaacgatatcatcgcccgcttc
gtcgacaagaagtcccctttcgtcgataccaagggccaatccttcgacatccccgccgac
ctcgcgaagaagccgctccccttcccctacctatacgcgctacccgtcgaggacgagatc
gcggcgatggtcaagggttcgcacaaggagagcggcggcaacgcgcttaagcggaaggag
gtcatcgcgaactttgaccgcctgcgggagcacaagatgggcgtgaaggagaaggtggag
gaggtgctgtcgcggcggtgcacggaagacaaggacgggttcctcgtgtggaattga

DBGET integrated database retrieval system