KEGG   Schizophyllum commune: SCHCODRAFT_28086Help
Entry
SCHCODRAFT_28086  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
scm  Schizophyllum commune
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:scm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SCHCODRAFT_28086
Enzymes [BR:scm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SCHCODRAFT_28086
Peptidases [BR:scm01002]
 Metallo Peptidases
  Family M67
   SCHCODRAFT_28086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 175 aa AA seqDB search
LKRVTVPRETLPRFLAIAKINTSLNRETCGLLLGKDRGHKYVVTTLLIPKQHATSDTCTM
DDEELVLEFTEERSLITLGWIHTHPSQSCFMSSVDLHTHSAFQCMLPESFAIVCAPKYNP
TFGIFRLTDPPGLKIILDCQAKEAFHPHPDKPIYTDADREHVYLKEAHLEIVDLR
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
ctcaagcgcgtgacggtgccgcgcgagacgctcccgagattcctcgcgatcgcgaagatc
aacacgtcgctgaaccgggagacgtgcgggttgttgctgggcaaggaccgggggcacaag
tatgtggtgacgacgctgctgatcccgaagcagcacgcgacgagcgatacgtgtaccatg
gacgatgaggagctcgtgttggagtttacggaggagaggagtttgatcacgctgggttgg
atccacactcacccatcgcaatcctgcttcatgtcatcggtagatctgcacacgcattcc
gccttccagtgcatgctgccggagtcgttcgccatcgtgtgcgccccaaagtacaacccg
acatttggtatcttccgcttgacagaccctccagggttaaagatcatcttggattgccag
gcgaaggaggcgttccacccgcatccggacaagccgatatataccgacgcggacagggag
cacgtctacctcaaggaggctcacctggagatcgtggacctccgc

DBGET integrated database retrieval system