KEGG   Schizophyllum commune: SCHCODRAFT_32018Help
Entry
SCHCODRAFT_32018  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
scm  Schizophyllum commune
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:scm04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 300 aa AA seqDB search
GVSGLKNLGNTCYANAPLQCLSATIPFAQFFKDTRWKNAINMHNTMGSKGVLSAAFAALV
HQMWSSESQLIPSEFMRAIRAINEQYKGSDQHDSQEFLSFLLDGIHEDLNRILKRENYTR
TPEQEAELERLPPQIASEQEWQAWRLRNDSIIVDYFQGQLRNQVKCLTCGQTSTTYNTFS
ILSLPVPHARAGGKAHLKQCLDAFFNSETLEKDDAWDCPRCKTKRSASKSLMLARLPPVL
VIHLKRFEAHGRFSDKIDTFVDFPLNGASTSPEDPRTQLPPYKYDLYGVTNHFGNLSSGH
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ggagtctcggggttgaagaacctggggaatacctgctatgcgaatgcacctctgcagtgc
ctgagcgcaacgattccgtttgcgcagttcttcaaggacactcggtggaagaatgctatc
aacatgcacaacacgatgggcagcaagggcgtactctctgcggcgtttgcggcgctcgtg
catcagatgtggtcaagtgaatcgcagcttatacctagcgagttcatgcgtgccatccga
gccatcaacgagcagtacaagggctccgaccagcatgattcgcaagagttcctgagcttc
ctgctcgatgggatccatgaggacctcaaccgaattctgaagcgcgagaactacacgcga
acaccggagcaggaagctgagctcgagcgcttgccgccgcagattgcgagcgagcaagag
tggcaggcgtggcggttgcggaacgacagtattatcgtggactactttcagggacagctg
cgaaaccaggtcaagtgcttgacatgtgggcagacatcgaccacgtacaacacgttctca
atcctttcgctgcctgtgccacatgcaagggccggcgggaaggcgcatctcaagcaatgc
ctggatgcattcttcaactcggagacgctggagaaggacgatgcatgggactgcccgcga
tgcaagacgaagcgcagcgctagcaagtcgctcatgcttgctcgtctcccgcctgtactc
gtcatccatctcaagcgtttcgaggcgcacggccggttctcggacaagatcgataccttc
gtcgacttccccctgaacggtgcttcgacgtcacccgaggatccacggactcagctgccg
ccgtacaagtacgatctttacggggtgacgaatcacttcggcaatctgagcagcggccat

DBGET integrated database retrieval system