KEGG   Schizophyllum commune: SCHCODRAFT_37924Help
Entry
SCHCODRAFT_37924  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SCHCODRAFT_37924
Peptidases [BR:scm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SCHCODRAFT_37924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 314 aa AA seqDB search
EPIDISWPDNVNGVGAGLFNTGNTCFMNSALQCLFHTPPLLRLLSAHSKDTCKSSGFCMT
CCMKYTAMRSQSSNKSAFNPDGITRNLKAFAKSLRYGRQEDSHEFLRHAIEGLQRSCLAG
QPQKVDPKLAETSWVHQLFGGQLRSRVHCKGCGHNSDTYDSILDLSLDIHRTSSLKDALK
SFVAPDYLKGSDKYKCDHCKKYVNAEKRFTINKAPLVLTIHLKRFSPFGSKLTNLLHYDE
HITLKPYMSEGSFGPRYSLYGVICHSGSGPNSGHYFSFVKSKQGRWYEMNDESVTPCSKP
YPMLKTAYMLMYIQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gagcccatcgacatctcctggccggacaatgttaatggcgtcggcgctggtctcttcaac
accggcaacacctgcttcatgaacagcgcactgcaatgcctcttccacacccctcccctt
ctccgtctactgtcggcgcactccaaggatacctgcaagtcgtccggattctgcatgacc
tgctgcatgaagtataccgcaatgcgatcacagtcgagcaataagtcggctttcaaccct
gacgggataacgcgcaacctgaaagcctttgccaagtctctaagatacggtagacaagaa
gacagtcacgaatttctgcggcacgcgatagagggcctgcagcgatcgtgcttggcgggt
caacctcagaaggttgatcccaagctggcggagacttcgtgggtgcaccagctctttggt
ggtcagctacgttcgcgagtgcactgcaagggctgcgggcacaacagcgacacgtacgac
agcatcctcgacctcagccttgatatccatagaacgagttctctcaaagacgcattgaaa
agtttcgttgctccggactacttaaagggatcggacaagtacaagtgcgaccactgcaag
aagtacgtgaacgctgagaagcgcttcacgataaacaaagcacccctagtactcaccatc
cacctgaaacgcttctcgcccttcggcagcaagctcaccaacctccttcactacgacgag
cacatcacgctcaagccctacatgagcgagggctccttcggcccacgctactccctctac
ggcgtcatctgccactccggctccggacccaactcggggcactacttctcgttcgtgaag
agcaagcaggggcggtggtacgagatgaacgacgagtcggtgacgccgtgctcgaagccg
taccccatgttgaagaccgcgtacatgctcatgtacatccaa

DBGET integrated database retrieval system