KEGG   Schizophyllum commune: SCHCODRAFT_38413Help
Entry
SCHCODRAFT_38413  CDS       T01331                                 

Definition
glycoside hydrolase family 20 protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
scm  Schizophyllum commune
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCHCODRAFT_38413
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    SCHCODRAFT_38413
   00603 Glycosphingolipid biosynthesis - globo series
    SCHCODRAFT_38413
   00604 Glycosphingolipid biosynthesis - ganglio series
    SCHCODRAFT_38413
   00511 Other glycan degradation
    SCHCODRAFT_38413
Enzymes [BR:scm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SCHCODRAFT_38413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 452 aa AA seqDB search
VFLTIGDSNHTLYNGDSTLEGYDFEITDTVYTISGSGTLGTWWGTRTLLQQAVLSASGDS
DALLIPTGSGSDSPGWEVRGFMLDVARHYFETSFVADMCVYASFFKLQTLHLHVSDFIYN
DPHLHTVGDAWKEDYAAFRLQPSEGSPIAGLVVGMENETWSYDDFTALQDTCTAHGVTLI
PEIDTPGHSLVFTKWKPELAIPLAPDFLNLSLPESTAIVKAAWDEVLPWFTASEVSIGAD
EYDSSLADDYIAFVNDMASYIANQSKKGTRIWGTYEPSDTSSVSKDVTIQHWNFPGDSIP
VQLMDQGYPVINSEQRFLYMVGKYSPYFPYELDQDLLWGSAPDGGGWAPNIFSADDQTNN
TSVDNPLLRGSIMALWNDYGNNASTPLDVYFQVAKSIATFAEKAWAGSRVRDTELTQEQF
EQVYPILEAKAPGQNLSRAVRGAAPGSTLVNY
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtctttctgaccatcggagactcaaatcacacgctctataatggcgacagcactctcgag
ggctatgacttcgagatcaccgatacggtgtacaccatctcgggctcaggtacacttgga
acgtggtggggcacgcgcactttgctgcagcaggcagtcctcagcgcctcgggcgactcg
gatgccctgctgatacccacgggcagcggatctgattcgcccggctgggaagttcgcggc
ttcatgctggatgttgctcggcattacttcgagacctcctttgtcgccgacatgtgcgta
tacgcgtccttcttcaagctgcaaaccttgcatctgcacgtttccgacttcatctacaac
gatccacacctgcataccgtgggagacgcgtggaaggaggactatgcagcattccgcctg
cagccgtcggaaggctctcccatcgccggcttggtcgtggggatggagaacgagacgtgg
tcttatgacgactttaccgccctccaagacacctgcaccgcacacggtgtcaccctcatc
cccgaaatcgacaccccaggccactccctcgtcttcaccaaatggaagcccgagcttgcc
atccccctcgcacccgacttcctcaacctctccctccccgagtccaccgccatcgtaaaa
gccgcctgggatgaagttctcccctggttcaccgcctccgaggtctccatcggcgcggac
gagtacgacagctcgctcgccgacgactacatcgccttcgtcaacgacatggcgtcgtac
atcgctaaccaaagcaagaagggcacccgcatctggggcacgtacgagccgagcgacacg
tcctcggtctcgaaggacgtgacgatccagcactggaacttcccaggggactcgattccg
gtgcagctcatggaccagggctatcccgtcatcaactccgagcagcggttcctctacatg
gtcgggaagtactcgccctacttcccctacgagctcgaccaggacctcctctggggcagc
gcgcccgacggtggtggctgggcgccaaatatcttcagcgcggacgatcagacgaacaac
acgtcggtggataatccgctgctgcgaggctcgatcatggcgctgtggaatgactatggg
aacaatgcgtcgacgccgttggatgtgtacttccaagtggcgaagagtattgcgacgttc
gcggagaaggcgtgggcggggtctagggtgcgggatacggagctcacgcaggagcagttc
gagcaggtgtacccgatcctggaggcaaaggcgccgggccagaatctgagtcgcgccgtg
cggggcgctgctccgggctcgacactggttaactac

DBGET integrated database retrieval system