KEGG   Schizophyllum commune: SCHCODRAFT_45736Help
Entry
SCHCODRAFT_45736  CDS       T01331                                 

Definition
glycoside hydrolase family 11 protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
scm  Schizophyllum commune
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 228 aa AA seqDB search
MFAKLIAFVAAVATVSASPLNATDIVDVSARSGTPSSTGTDGGYYYSWWTDGAGDATYQN
NGGGSYTLTWSGNNGNLVGGKGWNPGAASRSISYSGTYQPNGNSYLSVYGWTRSSLIEYY
IVESYGSYDPSSAASHKGSVTCNGATYDILSTWRYNAPSIDGTQTFEQFWSVRNPKKAPG
GSISGTVDVQCHFDAWKGLGMNLGSEHNYQIVATEGYQSSGTATITVT
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccaagctcatcgccttcgtcgctgctgtcgctaccgtctccgcctcgccgctc
aatgcgacggacattgtcgacgtctccgctcgttccggtaccccgagctcgactggtacc
gatggtggctactactattcttggtggacggacggcgctggtgacgccacctaccagaac
aacggtggtggatcgtacaccttgacctggtctggcaacaacggcaacctcgtcggcggc
aagggatggaacccaggagccgcgtcccggtccatctcctactccggcacctaccagccc
aacggcaacagctacctctccgtctacggctggacgcgcagttcgctcatcgagtactac
atcgtcgagtcctacggctcctacgacccgtcctccgccgccagccacaagggctccgtc
acctgcaacggcgccacgtacgacatcctctccacctggcgctacaacgcgccctccatc
gacggcacgcagaccttcgagcagttctggagcgtccggaacccgaagaaggcgccgggc
gggtcgatcagcgggaccgtcgatgtccagtgccacttcgatgcttggaaggggctcggg
atgaacctgggtagcgagcacaactaccagatcgtagccaccgagggctaccagagcagc
ggcactgcgaccatcacggtcacgtaa

DBGET integrated database retrieval system