KEGG   Schizophyllum commune: SCHCODRAFT_46126Help
Entry
SCHCODRAFT_46126  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
scm  Schizophyllum commune
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1442 aa AA seqDB search
MHTSTTDAVLDTAPPIPYWNTKRHLTCGNPTPAPSWSAKPTAWRPAPGKLKTSYAALVLC
LNIDVDPPDVVKTNPCAHLECWVDPHSMPSHKALEAIGNNLKHQFECLSLKIPYKPILDP
SYEDLRRFCQSLRRQAQDDAVLFHYNGHGVPKPTASGELWCFNRDYTQYIPVSLQEVQNW
LGAPGVYIWDCSAAGHLLTNFNIFAQRRDQEMQLQPGVYGSKPPYASSLQLAACLAHEQL
PSCPELPADLFTSCLTSPIDIALRFFLMNHQLPNNIKIDMVLQLPGDLKDRKTPLGELNW
IFTAITDTIAWTTFDHDTFTRLYRCDLLIACLFRNFLLAERIMKNYSCTPHTSPALPPTN
THPLWATWDLAVDTCLRQLPSLLYITPEDPKAAAPSPPQSGTNKPYVYMPSRFFSDQLTA
FEVWISPLDQKAEMQQLLNGQHHLVPRKPPDQLPIVLQVLLSQPHRLRALILLSQFVDLG
PWAVNLVLTIGIFPYISKLLQAAGQDLRPVLIFIWARIMAVDPSVQNDLYASHGYKYFSN
ILSLRDEHALPNSSEHKAMCSFILSALSRDFVHGQNACRHERVFDNCFDALNDGDFLLRQ
WSALCIAQMWDANDEMKIYGVDHGAQDRLVGLLSDDSVEVRCAALYALGTFFGASGSANP
QKRGGGGTGMMSQLDETVQFRMEIAVATGATLAIREDASPMCRKELLVMLSCLVKEWRGY
FIICAWLYWEEDRKWRLGGSVDEDDLASQAVAEWLDECPDDDTREGQRVLLSSFFTIFVC
LLDFSVDPYSEVSTHAQTIVDYIMALLLESPFSRVDSATLGSAPTRSFSPDRHHGHRSRL
SSVQMSPTIAPGSPSIARPSLSRADTVTSTFSSTLKRTGSFANALKSLANGISFPSTEDL
RLAPAALAPQPPKPDSDLTRPPSPNLNIASYSSPYPPPAVDTSDNFSNEPSDFYPSDVMQ
ALIAEDMERLRARRRTPHQAHHYQQLYGQPDMMPSPSSSTFSMESGIILGLGTGKNVRET
LPLKSVYYDFCCEYFKEPQMRVSEADEPGSIEYNYQVWRQQRNEIVNVETEHQAPIADSC
RWDRSVATIQTASYPLTIAFHSYDQHVVIANDKDTISVWDWSKRRRLCYFCNGNPRGTNI
TALEIVNQDIGGIIVSGSADGVVRLYRNYDPALQQGPLQMVSSWRAINELIYTDHGAGLI
MDWQQASGVLLVGGDSRTVKVWDAQTETSVSDLDTNSNAPLTSMTSDVAYPQTFVAGFAD
GAVKVFDRRLDDEQAIVRSYTEHNSWVQNVKWLPKGDRQPMSASLDGEVKLWDLRGSEMS
VQTWDTQSTGISAFDIHPLTSVFATTSAVTPNNWRSQRVLVQNAMDSPDTSLSSFMLPTG
LGTSPTRTFSTPYMPRWTSLAFHPKEMLYAIGAPDGNCTWSSYTSLRPSANFPSQCASWA
AN
NT seq 4329 nt NT seq  +upstreamnt  +downstreamnt
atgcacacctccaccaccgacgccgtcctggacaccgctccccccatcccttactggaac
accaagcgccatctgacctgcggcaaccctacccccgccccatcatggtcagccaagcct
acggcgtggaggccagcgcccggcaagctcaagacgtcttacgccgcgctcgtgctctgc
ctcaacattgatgtcgatcccccagacgtggtcaagacgaacccctgcgcgcacctcgag
tgttgggtcgatccgcattcaatgccctcgcacaaggcccttgaggcgatcggcaacaac
ctgaagcaccaattcgagtgcttgagcttgaagatcccatacaagcctatactagatccg
tcgtacgaggacctgcggagattctgtcagtctctgcggcggcaagctcaggatgacgcg
gtgctattccactacaatggacatggtgtgccgaagccaactgcgagcggcgagctgtgg
tgcttcaaccgtgactatacgcagtacatcccagtatcgctgcaggaggtgcagaactgg
ctaggggcgccgggcgtctacatctgggattgctccgccgctggccacctcctcaccaat
ttcaacatattcgctcagcgccgagaccaggagatgcagctgcagccgggcgtgtacggg
agcaaacccccctacgcgtcctcgctgcagctagcggcgtgcctggcgcatgagcagttg
ccgtcgtgcccagagttgccggcggacctattcacgtcctgcttgacgtcgccgatagac
atcgcgctgcggttctttctcatgaaccatcaactgccgaacaacatcaagatcgacatg
gtcttgcagttgccgggagacttgaaggatcgcaagacgccgcttggggagctgaactgg
atattcaccgccatcacggacaccatcgcgtggacgacttttgaccacgacaccttcacc
cgcctataccgctgtgacctgcttatcgcatgtctcttccgtaatttcctcctcgcggag
cgtatcatgaagaattactcatgcacgccacacacgtcgcccgctctaccaccgacgaac
acacatccactgtgggcgacttgggatctggctgttgatacgtgtctacgccaactcccc
agtctcctctacatcacgccagaagacccgaaggcggcagcacccagcccaccgcagagt
ggcacgaacaagccctacgtctacatgcccagccgcttcttctccgaccagcttaccgcc
ttcgaggtgtggatatcgccactcgatcagaaggcggaaatgcagcagctgctcaatggc
caacaccatctggtacccaggaagccgcctgaccagctgccaatcgtgctgcaggtcctg
ctgtcgcagccgcaccggctccgcgcgctcatcctgctctcgcaattcgtggacctcgga
ccgtgggcggtcaatctcgtcctcaccatcggcatcttcccctacatctccaagctcctg
caggccgctgggcaggacctccgccccgtcctcatcttcatctgggcgcgtatcatggcc
gtggatccctctgtgcagaacgacctctacgcgtcgcacgggtacaagtacttctcgaac
atcctcagcctgcgcgacgagcacgcgctgccgaacagctccgagcacaaggcgatgtgc
tcgttcatcctctccgcgctctcgcgcgactttgtacacgggcagaatgcatgccgccac
gagcgtgtgttcgacaactgcttcgatgcgctgaacgacggggacttcctcctcaggcag
tggtccgcgctgtgcatcgcgcagatgtgggacgcgaacgacgagatgaagatttatggg
gtggaccatggcgcgcaagaccgtctcgtgggcttactgtccgacgactcggtcgaggtg
cgatgtgcggcgctttacgcgctgggcacgttctttggcgcaagtgggtcggcgaacccc
cagaagcgcggcggcggaggaacaggaatgatgagccagctagacgagacggtccagttc
cggatggagatcgcggtcgcaacgggcgcgacgcttgccatccgcgaggacgcgagcccg
atgtgcaggaaggagttgctggtgatgctgagctgcttggtaaaggaatggcgcgggtac
ttcatcatctgcgcgtggctttactgggaggaggatcgcaagtggcggttgggcggtagt
gtcgacgaggatgatctagccagccaggcggtcgcagaatggctcgacgaatgtccggat
gatgatacacgggagggtcagcgggttctactatcgtcattcttcacgattttcgtctgc
ttgctcgacttctcagtcgacccgtatagcgaggtctcgacgcacgcgcagacgattgtg
gactatatcatggcgctgctccttgagtcgccctttagccgcgtcgactcagctactctg
ggatctgcaccgacacggagcttcagcccagatcggcaccatggtcatcggtcacggctt
tcgtcagtgcaaatgtcacctacgatcgctccagggtcccccagtatcgctcggccatca
ttatctcgcgccgacacagtgacgagtaccttctccagcactctcaagcgcactggctcc
ttcgccaacgcgctcaagtccctcgccaatggcatttccttcccctccaccgaggacctg
cgcctcgcccccgccgccctcgcccctcagccacccaaaccagactccgaccttacccgc
cctccatcccccaacctcaatatcgcaagctactcttcgccctatcctccacctgctgtg
gatacatccgacaacttctcgaacgagcctagcgacttctacccgtcggacgtgatgcag
gcgctgattgcggaagacatggagcgcctgcgtgcgaggcgaaggacaccgcatcaggcg
caccactaccagcagctgtacgggcagccggacatgatgccgagcccgagcagcagcacg
ttctcgatggagagtgggatcatcctgggtttgggtacgggaaagaatgtacgggagacg
ctgccgttgaagagcgtgtactatgacttctgctgcgagtacttcaaggagccgcagatg
cgggtatcggaagcggacgagccaggaagcatcgagtacaactatcaggtgtggcggcag
caaaggaatgagatcgtcaacgtcgagacggagcatcaagcaccgattgcagattcgtgc
cgctgggatcgctctgttgcgacgatacagacggcgagctacccgttgacgatcgctttc
cactcctacgatcagcacgtcgttatagcgaacgacaaggacacgatcagtgtctgggac
tggtccaagcgaaggcgactatgttacttctgcaacggcaatccgcgagggacgaacatc
accgcacttgagatcgtcaatcaagacatcggtggtatcattgtgtccggatcagcggat
ggtgttgtccgtctgtatagaaattatgacccggcgctgcagcaaggcccgttgcagatg
gtatcgtcgtggcgagcgatcaacgaactgatatacacggaccatggcgcgggcttgatc
atggattggcagcaggcgtctggtgtgctgcttgttggcggagactcgcgcacggtcaag
gtttgggatgcgcaaaccgagacgtcggtgtcggatctcgataccaactccaacgcgcca
ttaacgtcaatgacaagcgacgttgcttacccgcagacgttcgttgcgggcttcgcggac
ggcgcagtcaaggtcttcgaccggcgtttagacgatgagcaggcgatcgttcggtcgtac
acagagcacaactcgtgggtgcagaatgtgaagtggctcccgaaaggcgatcgtcagccc
atgtcggcaagcctggatggcgaggtgaagttgtgggatttgcgagggagtgagatgtct
gtacagacttgggacacgcagagcactgggatctccgcctttgacatccatccgctgaca
tcggtctttgcgaccacctccgcggtcacgcctaataattggagaagtcaacgtgttcta
gtgcagaacgcgatggactcgccggatacttccctctcgtcattcatgttgcccaccggt
ttgggaacctcgcctacgcggacgttctccactccctacatgcctcgttggacgtcgctt
gccttccacccgaaggaaatgttgtatgcgattggcgccccggatggaaactgtacgtgg
tcttcctacacatcgttacgtccctcggctaactttccctctcagtgcgcatcatgggct
gcaaactag

DBGET integrated database retrieval system