KEGG   Schizophyllum commune: SCHCODRAFT_46225Help
Entry
SCHCODRAFT_46225  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
scm  Schizophyllum commune
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:scm01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:scm01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 386 aa AA seqDB search
MSSSTTTKTASDAPVREPEIWWSNAIFFSLTHIAAIVGVYYYPPTAVPWQTLVFAFLTWQ
LADFGITMGYHRLYSHRAYRAALGVRVVLALLGTIAFQGSIKWWCLRHRLHHVRIPVTYR
YAATRGLFYSHMGWIFYKPVYERIGLVDRQDLDSDPVPLAVSLGFVAPSLIGMLWSDPVG
TYIWAGLVARLFSALAHWDGLQPYSDENTSRGNLILALLTGGEGNHNFHTFPHDYRSGPS
YLDWDPTKWIIAALHRLGFVKGLRRARDADLRAALAHMQLKGHHHHETSDEEDDEPWTGP
VWGVAELKAKASQGACLLIIEGYVVDATAYLGEHPGGASILRKYAYSSKLEETIDATWAF
EGGLNNHSWPARRGMRELRVAKFNVD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcctcgacgacgacgaagacagcgtcggatgcgccagtacgcgaaccagagata
tggtggagcaacgccatattcttctcacttacccacatcgctgctatcgttggcgtctac
tactatcctccgaccgcggttccatggcagacactcgtgtttgcattcctaacctggcag
ttggcggacttcggcataacgatggggtaccaccggttgtacagccatcgcgcctaccgc
gccgctttgggagtgcgcgtcgttcttgcactcctcggaactatcgcattccaggggtcc
atcaagtggtggtgcctccgccacagattgcatcacgtacgcattccagtaacatacaga
tatgcagccacacgcggcctgttctattctcacatgggctggatattctacaagccagtc
tacgaaaggataggccttgtagatcgacaagacctggatagtgatcctgtgcccctagcc
gtctcattgggcttcgtcgcaccatcgttgattggcatgctgtggtcagatcctgtgggc
acatacatttgggcagggctggtggcaagactattcagtgcactggcgcactgggatggc
ctgcagccgtattccgacgagaacacatccagaggcaatctaattttggcccttctgacc
ggaggagagggtaatcataactttcataccttcccgcacgattaccgctccgggccgtcg
tatttggactgggatcccacgaagtggatcatcgcggccttgcatagactcggatttgtg
aagggcttgcgccgggctcgtgatgcagacctacgagcggcgctggcgcatatgcagttg
aagggacatcaccaccacgaaacatcagacgaggaagatgacgagccatggactggtcct
gtttggggtgtcgctgagctcaaggccaaggctagccaaggggcatgcttgttgattatc
gagggctatgtggtggacgcgacagcttatctaggcgagcaccctggtggcgcatctata
ctgcgaaaatacgcgtacagctcaaaactggaagagaccatcgatgcgacatgggctttc
gagggtggtctgaataaccactcgtggcctgcacgtagagggatgcgggagctgagggta
gccaaattcaatgtagattag

DBGET integrated database retrieval system