KEGG   Schizophyllum commune: SCHCODRAFT_46389Help
Entry
SCHCODRAFT_46389  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
scm  Schizophyllum commune
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SCHCODRAFT_46389
Enzymes [BR:scm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     SCHCODRAFT_46389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 306 aa AA seqDB search
PFLFVQHRVPGSPDSDPRYQKGVLDFVLIAYYIVFWSLCRILIAGRLFTRIGRFYGLKKE
GKLDRVGEQGYAIVYYTASGLWGLRIMSQLPIWWYRTEEFWLGYPHWDMIPELKQFYLMQ
SAHWLHELMIMVLGFEKPRKDFAELVAHHAVTLWLVGWSYLINLTHIGISVFVSMDIPDV
LLALSKLLNYLQFPRAKVAVFVVFFGVWSYFRHWLNLVILHSVWTEFDLIPEIHRRWAPP
TGAWLTWWMKYQIFAPILLLQILNLFWYYLMWRILIRAIRTAGEASDVRSDDEDDGEEEE
EGAKEK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
cccttcctcttcgtgcaacatcgcgtgcccggctcgccagacagtgatccgcgctaccag
aagggtgtcctcgacttcgtgctcatagcatactacatcgtgttctggtcgctatgccgc
atcctcatcgcggggcgtctcttcacgcgtatcgggcgcttctacggcctcaagaaggag
ggcaagctcgaccgcgtcggtgagcaggggtatgcgatagtgtactacactgcgtctggt
ctctggggcttgaggattatgtcgcaactccctatctggtggtaccgcacggaagagttt
tggctcggctacccgcactgggacatgatacctgagctcaagcagttctacctcatgcag
tctgcgcactggcttcatgaacttatgatcatggtcctcggctttgagaagccccgcaaa
gactttgccgagctcgttgcgcatcatgcggtcaccctctggcttgtcggatggagctac
ttgatcaaccttacccacattggtatctcggtcttcgttagcatggatattccggatgtt
cttctggctctttccaaattgctgaactacctgcaattcccgcgtgccaaggtcgccgtc
ttcgttgtcttcttcggcgtatggagttacttccgccactggctgaacctggtcatcctc
cactccgtctggaccgagtttgacctcattcccgaaatccaccgccgctgggcacccccg
accggcgcctggctcacttggtggatgaagtaccagatcttcgcgcccatcctcctcctc
cagatcctcaacctgttctggtactacctgatgtggcgcatcctgattcgcgccatccgt
acggccggtgaggcgagcgatgtgcggtcggacgatgaggatgatggggaagaggaggag
gagggggcgaaggagaagtag

DBGET integrated database retrieval system