KEGG   Schizophyllum commune: SCHCODRAFT_47140Help
Entry
SCHCODRAFT_47140  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
scm  Schizophyllum commune
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCHCODRAFT_47140
   00052 Galactose metabolism
    SCHCODRAFT_47140
Enzymes [BR:scm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SCHCODRAFT_47140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 364 aa AA seqDB search
PLETVNITAPDGSARASFIAHGAAATSFWVQDKYGEFRDILVGYENKVSIGTSDYIAARN
YFAPIVGRYANRIRNGTFTIPISKNAEGPGEKYQVPENEHNGTNSLHGGDKGFDTHVWSI
VDNGTDFVSFGMVDPAGNQGFPGTVITTVTYTLGNSSVFNTSISAIATEKTPIMLSAHQF
WNLEAYNETQDLSGHIAQIQSSRVIATDGNLIPNGSFIDVEETALDFRQAKSIGDSINAT
AEAQYCGTDCVGFDNAWVYDNNTGDAPVLSVWSENSGIRLDVFTNQLALQIYSCNAEYNA
TNPTPRKNSQGGPDAYIEDHSCIVLEQESYLDAINNPEYGIDDIYGPDKPYFWHSSYVFS
VIDE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
ccgcttgagacggtgaacatcaccgcgccggatggctcggctcgggcgagcttcatcgcg
catggcgcggccgcgacgagcttctgggtgcaggacaagtacggcgagttcagggatatc
ctcgtcggctatgagaacaaggtaagcatcgggacttcggactacatcgccgcacgcaac
tacttcgcgcccatcgttggccgttacgcgaaccgcatccgcaatggcaccttcaccatc
cccatctcgaagaacgcggaggggccaggcgagaagtaccaggtaccggagaacgagcac
aacggcacgaactccctccacggcggcgacaagggcttcgacacccatgtctggagcatt
gtcgataacgggacggactttgtcagctttgggatggtggacccagcagggaaccaagga
ttcccgggcacggtcatcaccacggtgacctacaccctgggcaactcctccgtcttcaac
acatccatatctgcaatcgccacggagaagacgccaataatgttgagcgcgcaccagttc
tggaatcttgaggcgtacaacgagacgcaggacttgagtgggcacatcgcgcagatccaa
tcatccagagtgattgcgacggatgggaacctcattccgaacggctcgttcattgatgtg
gaggagacggcgttggacttccgccaggcgaagtcgattggcgactcgatcaacgcgacg
gcggaggcgcagtactgtggtaccgactgtgtagggtttgataacgcgtgggtttacgac
aacaacactggggacgcacctgttctgtctgtgtggagcgaaaactctggcatccgtctc
gatgtcttcacgaaccagctagcgctgcaaatctacagctgcaacgctgaatacaacgcg
acgaacccaacaccccgcaagaacagccagggcggccccgacgcatacatcgaggaccac
tcctgcatcgtcctcgagcaagagtcctacctcgacgcgatcaacaacccggagtatggg
atcgacgacatctatggccctgacaagccgtacttctggcactcttcgtatgtgttctcg
gtcatcgacgagtga

DBGET integrated database retrieval system