KEGG   Schizophyllum commune: SCHCODRAFT_47169Help
Entry
SCHCODRAFT_47169  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
scm  Schizophyllum commune
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCHCODRAFT_47169
Enzymes [BR:scm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SCHCODRAFT_47169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 286 aa AA seqDB search
MPSSSALLIRAPDAEKPDRYESAFAEAGFAAASVAALDTGFVNDDSLDAAIRERASEFDG
VIVTSSRACEAWKRSLTKHADSSHIDGWATTPFYAVGRATAVALRTIADSPAAPRDIRGE
ESGTGEQLARFIVEDIRKDDAERGHPARLLYLTGDKNRDTVPSILTEAGISFEPLQVYGT
CGAPDFEQRLDEALADLPSDTTEQWVVFFAPSSTDFALPYLHERFELRREVASLSGTQKA
ARIAAIGPMSSEHISRERHLHVDAVASKPSPAQLVEAIRTAAAMSP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctcatcagccctcctcattcgcgcacccgacgccgagaagcccgaccggtac
gagagtgcattcgcagaggcaggattcgctgcagcttccgtcgctgcactcgatacgggc
ttcgtcaacgatgacagtctggacgctgctatccgcgagcgggcgtccgagtttgacggc
gtcatcgtaacgagctcacgcgcgtgcgaggcgtggaagcgttcgcttacgaagcatgct
gatagctctcacatagatggctgggcgaccacccccttctacgcggttgggcgtgctact
gccgtcgcgttacgcaccatcgctgactcccccgccgcaccgcgcgacatccgcggcgag
gagtctggaactggagagcagctcgctcgcttcattgtcgaggacattcgcaaggatgat
gcggagcggggccatccagcgcgcttgctatacctcactggagacaagaatcgagatact
gtgcccagcatcctgactgaggcgggcatctcgttcgagccgctgcaagtgtatggaact
tgtggggcaccggatttcgagcaaaggctggacgaggcgctggcagatcttccgtcagac
acgacagagcaatgggtcgtcttcttcgctccctcctcgaccgacttcgccttgccgtat
cttcatgagcgcttcgagctcagacgagaggttgcctcattatcgggtacacagaaggca
gcacgtatcgccgccattgggcctatgtcctctgaacatatatctcgcgaacgtcatcta
catgtagacgcagtcgcgtcgaagccatcccctgcacagctggtcgaggcgatacgtacc
gctgctgcgatgtctccctag

DBGET integrated database retrieval system