KEGG   Schizophyllum commune: SCHCODRAFT_47248Help
Entry
SCHCODRAFT_47248  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
scm  Schizophyllum commune
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SCHCODRAFT_47248
Messenger RNA biogenesis [BR:scm03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     SCHCODRAFT_47248
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     SCHCODRAFT_47248
Translation factors [BR:scm03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    SCHCODRAFT_47248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 185 aa AA seqDB search
MEDIKRVISFDSVEEFWGLYNNIIPPSQLPQKANYYLFKEGIIPAWEDDANKNGGKWSIQ
LPKEKHRSVVDRMWLYTMLAAIGETFDPTLVRESPDSPAPESLITGVIVSTRPQFYRISI
WTRLAPSSPEDQLKTRIEQIGKHFKTSVLGYADGAKLGGPLATEVEFLSHKDSEKKGKSA
KKLIA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggaggatatcaagcgtgtaatcagttttgacagcgtggaggagttctgggggctgtat
aacaacataataccgccctctcaattgcctcaaaaggcaaattactacctcttcaaggag
gggattatccctgcttgggaggacgatgccaacaagaacggtgggaagtggagcatccag
cttcccaaggagaagcaccggagtgttgttgacagaatgtggctctacacaatgttggcc
gcaatcggcgagacgtttgatcccactttggtcagggagagccccgacagccccgcgcca
gagtctcttattacgggtgtcatcgtctctacacgaccgcagttctatcgtatctcgata
tggacgcggctcgcaccgtcctcgccagaggatcagctcaagactcggattgagcagatc
ggcaagcacttcaaaacgtcggtccttggctacgcggacggtgccaagcttggtggtcct
ctcgcgacggaggtcgagttcttgtcacacaaggactcggagaagaagggaaagagtgcg
aagaagctaatcgcgtaa

DBGET integrated database retrieval system