KEGG   Schizophyllum commune: SCHCODRAFT_47823Help
Entry
SCHCODRAFT_47823  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
scm  Schizophyllum commune
Pathway
scm00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCHCODRAFT_47823
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SCHCODRAFT_47823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9 tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 9594739
NCBI-ProteinID: XP_003037524
JGI: Schco1_47823
UniProt: D8PK57
Position
Unknown
AA seq 317 aa AA seqDB search
MSSVNIPGVGEVDTTAAAEYVQGLHSVQIPGVGTVDLLQLVSTPAFALSMTVATAAFFYA
LSNKGGKKALDPTKWQEYPLAKITKISPNTAIYTFALPNKNDILGLPIGQHISVSAEING
KDIMRSYTPISSDDDRGRFDLLIKAYEKGNVSRYFSLLKVGDKVRIKGPKGAFTYSPGLA
SHVGMIAGGTGITPMLQVVKAALKDANDKTKLTLIYANVNYEDILLKKEIDALAEAHPDQ
FSVYYVLNNPPEGWLGGVGFVTKDMIEKHMPPSSMKDAKVLMCGPPPMLTAMKGHLAELN
YPAPRTISKLADQVFCF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagtgaacatccccggcgtcggcgaggtcgacacgaccgcggcggcagagtat
gtgcagggcctgcactcggtgcagataccgggtgtgggtacggtggacctgttgcaattg
gtgtcgacgccagcgttcgcgcttagcatgacggttgcgaccgccgcgttcttctatgcg
ctctcgaacaagggcggcaagaaggcgctcgacccgacaaaatggcaggagtacccgctg
gcgaagatcaccaaaatctccccgaacacggccatctacacgttcgccctccccaacaaa
aatgacatcctcggcctgccaataggccagcacatctccgtgtccgccgagatcaacggg
aaggacatcatgcgctcgtacacccctatctcaagcgacgacgaccgtggccgcttcgac
ctgctcatcaaggcgtacgagaagggcaacgtgtcgcggtacttctccctcctcaaggtc
ggcgacaaggttcgcatcaagggccccaagggcgcattcacctactcccccggcctcgcc
tcgcacgtcggcatgatcgctggcggtaccggcatcacccccatgctgcaggtcgtcaag
gccgcactgaaggacgcgaacgacaagacgaagctcacgctcatctacgcgaacgtcaac
tacgaggacatcctgctcaagaaggagattgacgcgctcgcggaggcgcaccctgaccag
ttcagcgtgtactacgtgctgaacaacccgccagagggctggttgggcggtgtcgggttt
gtgacgaaggacatgattgagaagcacatgccgccgagctcgatgaaggacgcgaaggtc
ctgatgtgcggcccgccacctatgctcactgcgatgaagggccaccttgccgagctgaac
tacccggcaccaaggacgatcagcaagctcgctgaccaggtcttctgcttctga

DBGET integrated database retrieval system