KEGG   Schizophyllum commune: SCHCODRAFT_47823Help
Entry
SCHCODRAFT_47823  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
scm  Schizophyllum commune
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scm00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 317 aa AA seqDB search
MSSVNIPGVGEVDTTAAAEYVQGLHSVQIPGVGTVDLLQLVSTPAFALSMTVATAAFFYA
LSNKGGKKALDPTKWQEYPLAKITKISPNTAIYTFALPNKNDILGLPIGQHISVSAEING
KDIMRSYTPISSDDDRGRFDLLIKAYEKGNVSRYFSLLKVGDKVRIKGPKGAFTYSPGLA
SHVGMIAGGTGITPMLQVVKAALKDANDKTKLTLIYANVNYEDILLKKEIDALAEAHPDQ
FSVYYVLNNPPEGWLGGVGFVTKDMIEKHMPPSSMKDAKVLMCGPPPMLTAMKGHLAELN
YPAPRTISKLADQVFCF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagtgaacatccccggcgtcggcgaggtcgacacgaccgcggcggcagagtat
gtgcagggcctgcactcggtgcagataccgggtgtgggtacggtggacctgttgcaattg
gtgtcgacgccagcgttcgcgcttagcatgacggttgcgaccgccgcgttcttctatgcg
ctctcgaacaagggcggcaagaaggcgctcgacccgacaaaatggcaggagtacccgctg
gcgaagatcaccaaaatctccccgaacacggccatctacacgttcgccctccccaacaaa
aatgacatcctcggcctgccaataggccagcacatctccgtgtccgccgagatcaacggg
aaggacatcatgcgctcgtacacccctatctcaagcgacgacgaccgtggccgcttcgac
ctgctcatcaaggcgtacgagaagggcaacgtgtcgcggtacttctccctcctcaaggtc
ggcgacaaggttcgcatcaagggccccaagggcgcattcacctactcccccggcctcgcc
tcgcacgtcggcatgatcgctggcggtaccggcatcacccccatgctgcaggtcgtcaag
gccgcactgaaggacgcgaacgacaagacgaagctcacgctcatctacgcgaacgtcaac
tacgaggacatcctgctcaagaaggagattgacgcgctcgcggaggcgcaccctgaccag
ttcagcgtgtactacgtgctgaacaacccgccagagggctggttgggcggtgtcgggttt
gtgacgaaggacatgattgagaagcacatgccgccgagctcgatgaaggacgcgaaggtc
ctgatgtgcggcccgccacctatgctcactgcgatgaagggccaccttgccgagctgaac
tacccggcaccaaggacgatcagcaagctcgctgaccaggtcttctgcttctga

DBGET integrated database retrieval system