KEGG   Schizophyllum commune: SCHCODRAFT_49768Help
Entry
SCHCODRAFT_49768  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K03859  
phosphatidylinositol glycan, class C
Organism
scm  Schizophyllum commune
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    SCHCODRAFT_49768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 288 aa AA seqDB search
MADEPWEKVLWKKQPYPDNYIPEGLFLSSLRRNPNFRPYTYWQLVFLSFAITQHLASIAI
FVSAFTMLKDHVLDPRVLLWLSIAGFFLGHFVWEVLVRAISDRERRREDRMRAVKASILL
FLALMCLAPVLRTLTAATSSDSLWAMAAALFILNALLADYTPMPGHARERLTSVLSTNAA
ISSSVVLASRLAHDLAVFALTLFAVEVFALFPMLRRRLQVGFAAHAGLTVALVLLALSLS
ARVSATAPWLYAAIFTFVTFAAPAMLVWAQQYKNEIRGQWDVAVPKVK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaaccatgggagaaggtgctgtggaagaagcagccatacccggataactac
attccggagggcctattcctgtcgtctctgcgaagaaatccgaacttccggccgtatacc
tactggcagctcgtcttcctgtcgttcgcgataacccagcacctagcaagcatcgccatc
tttgtctccgcgttcacgatgctcaaggatcatgtcctcgacccgcgtgtgctgctttgg
ctgtccatagctggctttttcttgggacatttcgtttgggaggtgttggtgcgcgcaata
tccgaccgcgaaaggcggcgggaggaccgcatgcgtgcggtcaaggcctccattctgctc
ttcctcgcgctcatgtgcctcgcgccagtgctccgcacgctcaccgctgctacgtcttcc
gactccctctgggccatggcggctgcgctcttcattctgaacgcgctcctcgcggactac
acccccatgcccggccacgctcgcgaacgcctgacgtcggttctgtcaactaatgccgcc
atctcgtcctccgttgtcctcgcctcacgcctggcgcacgatctggccgtgttcgcgctc
acgctcttcgcggtggaggtcttcgccctgtttccgatgctgcgccgccggcttcaggtg
gggttcgctgctcacgctggcctcacggtggcgcttgtgcttctcgcgctttccctcagt
gcccgtgtctccgcaacagcaccgtggctctatgccgcgatcttcacttttgtcacattt
gcggcaccagctatgcttgtctgggctcagcagtacaagaacgaaatccgcggacaatgg
gacgtcgcggtgcccaaagtcaagtag

DBGET integrated database retrieval system