KEGG   Schizophyllum commune: SCHCODRAFT_53899Help
Entry
SCHCODRAFT_53899  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SCHCODRAFT_53899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 229 aa AA seqDB search
MAWRSHGKTNVELISNMARNGIIEADRVINAMKKVDRANYVLDKSKAYEDRPQSIRYDAT
ISAPHMHAYASEHLLPYIKPGARILDVGSGSGYLTAVLYHLASEDPSRPGKVVGIEHVPE
LVQFSIENLKKDGLGDALESKAIEMIAGDGRQGYAAGGPYNAIHVGAAAPELPQPLVDQL
ASPGRMFIPVGVDAQYIMHVDKDENGKVTQSQVMPVQYVPLTGRPAASP
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcttggcgaagtcacggcaaaactaacgtcgagttgatctcgaacatggcacgcaat
ggaattatcgaggccgaccgcgtcatcaatgcgatgaagaaagtggatcgcgcaaattat
gtcttggataagagtaaggcttacgaagacaggcctcagtccatcaggtacgatgcaaca
atcagcgcgccccatatgcacgcatacgcatcggagcacctcttgccatacatcaagccc
ggcgcgcgcattctcgacgtcggtagcggctctggctatctgaccgctgttctgtaccac
ctcgcaagcgaggatccatctcgacccgggaaggtcgtcggcatcgagcacgtacccgag
ctcgtccagttctctatagaaaacctgaagaaggacgggctcggagacgctttggagagc
aaggctatcgagatgatcgcgggggatggcagacagggctacgcagcaggcgggccgtac
aacgctatccatgtcggcgcggcagcacccgagcttccacagccgctggtcgatcagctt
gcctcgcctgggcgcatgttcatcccggtgggcgtggacgcgcagtacatcatgcacgtc
gacaaggatgagaatggaaaggtcacacagagccaagtcatgccagtgcagtacgtgccg
ctgacagggcgcccggcagcttcgccatga

DBGET integrated database retrieval system