KEGG   Schizophyllum commune: SCHCODRAFT_54429Help
Entry
SCHCODRAFT_54429  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
scm  Schizophyllum commune
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:scm01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:scm00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:scm00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:scm00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 266 aa AA seqDB search
GRYVAALARNACFEATCPHCGVGADNLCVANFPIGFGTDGFYAPYCVVRAKTVVPVPASR
DELPPEIVAVSTDAVLTSWHALKANANIQPGQTVLIIGAGGLGLNGVQIAKNVLGAKCVI
ACDVRESSLEDAKALGADYTALPDALPALLTDNHLTVDVACDFVGLNDTFNAALKAVRPK
GILQVIGLTAPTVDLPLIPAADKDLTIRFSMWGKLSELREVLEYVREGKITPKVETRPLG
SLVETFEDFMAGKIKSRMVLIPEHEG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ggccgctacgtcgccgccctcgcgcgaaacgcctgcttcgaggccacctgcccccactgc
ggcgtcggcgcggacaacctctgtgtcgcgaacttcccgattggattcggcacggacggc
ttctacgcgccgtactgcgtggtgagggcgaagacggttgtcccagttccggctagtcgg
gacgagctgcctcctgagatcgtggccgtctcgacggatgcagtgctgacgtcgtggcac
gcgctgaaggcgaatgcgaatatccagcctgggcagacggtgcttatcattggcgcgggc
gggctgggcctcaatggagtgcagattgcgaagaatgtcctgggcgcgaaatgcgtgata
gcatgcgacgtgcgagaatccagcttggaagatgccaaagccctcggcgccgactacacc
gccctacccgatgcgctccccgccctcctcactgacaaccacctcaccgttgacgtggcc
tgcgatttcgtgggtcttaacgatacattcaacgctgccctcaaagctgtccggccgaag
ggaattttacaagtcatcggcctcactgcgcctacagtcgacttgcccctcatccccgcg
gcggacaaggacctgacgatccgattcagcatgtggggtaagttgagcgagctgagggaa
gtactagagtacgtgagggaggggaagatcacgccgaaagtggaaacgcggccgttgggg
agcttggttgaaacctttgaggattttatggccgggaagatcaagagtcggatggtgctg
atacctgagcatgagggatga

DBGET integrated database retrieval system