KEGG   Schizophyllum commune: SCHCODRAFT_55414Help
Entry
SCHCODRAFT_55414  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SCHCODRAFT_55414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 261 aa AA seqDB search
MFDDILTPEERDTSKTEITPEDTRRFEAARTRAEVRLRAASCCTQPVASSPAPVEAQPPG
VGQRIQCIRFGPYDIKTWYDAPFPEEYSNIPDGRLWLCEFCLKYMKSRLTAGRHKLKCKM
RHPPGDEIYRDGAVSIFEVDGRRNKIYCQNLCLLSKMFLDHKSLFYDVEPFLFYVMTEVD
EVGARFVGYFSKEKRSHKDYNLSCIMTLPVRQRQGFGNLLIDFSYLLSKREQRLGSPEKP
LSGLGALGYRNYWKLAVHRYL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacgacatcctcacgcccgaggagcgagatacgtccaagacggagatcacgcct
gaggatacgcggagatttgaggcggcacgcacgcgagctgaggtgcgtcttcgagctgcg
tcttgctgcacgcagcctgtcgcgtcgtcgcccgcccccgtggaggcacaaccgccggga
gttgggcagcgcatccagtgcatccgctttggcccctacgatatcaagacgtggtacgat
gcgccgttcccggaagagtactcgaatattcccgatgggaggctttggttgtgcgagttt
tgcctgaagtatatgaagagtcggttgacagcggggaggcacaagctgaagtgcaagatg
cgacatcctcctggcgatgagatatatcgcgatggggcggtgtcgatcttcgaggtagac
gggcggcggaacaagatatactgccagaacctctgccttctttcgaagatgtttctcgac
cacaagtcactcttttacgacgtcgagcccttcctattttacgtcatgacggaagtcgac
gaagttggcgcgcgcttcgttggctacttcagcaaggagaaacgtagtcataaggactac
aatctgagctgcatcatgacgttgccagtacgccagcgccagggctttgggaacctcttg
atcgacttcagctacctattgtcgaaacgagagcaacggctgggctcgccggagaaaccg
ctctcggggctcggcgcactcgggtatcgtaactactggaagctcgccgtgcataggtat
ctt

DBGET integrated database retrieval system