KEGG   Schizophyllum commune: SCHCODRAFT_55478Help
Entry
SCHCODRAFT_55478  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
scm  Schizophyllum commune
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SCHCODRAFT_55478
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SCHCODRAFT_55478
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SCHCODRAFT_55478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 164 aa AA seqDB search
MSENYGFYSLKAELGNGKEFDFAELKGKVVLIVNVASKCGFTPQYKGLQALYDKYKDKGF
VILGFPCNQFGHQEPEDDANIATFCERNHGVTFPLMKKSDVNGDHTNEVYKWLKNQKAGI
LGLTRIKWNFEKFLVDKNGNVVHRWASTTTPETIDAEVAKLLEQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaactatggcttctactccctcaaggccgagctcggcaacgggaaggagttc
gacttcgccgagctgaagggcaaggtcgtgctgatcgtgaacgtcgcgtcgaagtgcgga
ttcacgccgcagtataagggcttgcaggcgctgtacgacaagtacaaggacaagggcttc
gtgatcctcgggttcccctgcaatcagttcgggcaccaggagccggaggacgacgcgaac
atcgcgacgttctgcgagcgcaaccacggcgtgaccttccccctcatgaagaagtcggat
gtgaacggcgaccacacgaacgaggtctacaagtggctgaagaaccagaaggcgggcatc
cttggcctcacgcgcatcaagtggaacttcgagaagttcctcgtcgacaagaacggcaac
gtcgtccaccgctgggcatccaccaccacgcccgagacgattgacgccgaggtcgcaaag
cttcttgagcagtaa

DBGET integrated database retrieval system