KEGG   Schizophyllum commune: SCHCODRAFT_55905Help
Entry
SCHCODRAFT_55905  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
scm  Schizophyllum commune
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 347 aa AA seqDB search
DDKEGHYIIVPDDIIANRYRTVRLLGQGTFGKVVEAVDTQTKQRVAIKIIRAVPKYRDAS
KMEIRVLKKLKESDPLNRHKCIHLLSWFDHRNHICLVSELLGMCLYDFLKENDFAPFPRH
QIQSFARQLLGSVAFLHDLHLIHTDLKPENILLVHNDYKTVRIPRSAAKDKRILLSTDIR
LIDFGSATFEHEYHSSVVCTRHYRAPEIILGLGWSYPCDVYSLGCILVEFYTGIALFQTH
ENLDHLAMMEIVMGRVPDRFARQGARQHPEWFKDGRIDFPKTKSTRQSKKDVRATKPLRD
IITSSDMINRHFLDLVTKLLAWDPAQRITVREALSHPYFSLSIPEEI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gatgacaaggagggccactatatcattgtacccgacgacatcatagccaaccgataccgt
acagtacggcttctcggtcaggggacgttcggcaaagtcgtggaggcagtcgacacgcag
accaaacagcgtgtggccatcaagatcatccgagccgtgccgaagtatcgcgacgcgagc
aagatggaaattcgcgtcctcaagaagttgaaggagagcgatccgctcaatagacacaaa
tgcatacacctcttatcgtggtttgatcatcgcaaccatatatgcctggtctcggaactg
ttgggcatgtgcctgtacgatttcctcaaggagaatgacttcgcaccgtttccgcgccat
caaatccagtcatttgcgaggcaactcctcgggagtgtggcgttcttgcacgatctacac
ctcatccacaccgacctgaagcccgagaacatcctgctagtacacaacgactacaagacg
gtcaggatacctcgaagcgcggcaaaggacaagcggatcctgctatcaaccgatatccgc
ttgatcgacttcggctcggctaccttcgaacacgagtatcactctagcgtcgtctgtaca
agacattaccgagcaccagagatcatactgggcctaggctggtcatacccctgtgacgtc
tactcgcttggctgcattctcgtcgagttctacaccggtatcgccctattccagacgcac
gaaaacctcgaccatctcgcgatgatggagattgtcatgggcagagtacccgaccgcttc
gcacggcagggcgcaagacagcaccccgagtggttcaaggacggtcgcatagacttccca
aagacgaagtcgacgaggcaaagcaagaaggacgttcgcgcgacgaagcccttgcgggac
atcatcacgagctcagacatgatcaaccggcatttccttgacctcgtcaccaagctgcta
gcctgggacccggcgcagcgcatcacggtccgcgaggcgctcagccacccgtacttctcg
ctcagcattcctgaggagatctaa

DBGET integrated database retrieval system